PDB entry 5j1b

View 5j1b on RCSB PDB site
Description: structure of the core domaine of knr4, an intrinsically disordered protein from saccharomyces cerevisiae - wt.
Deposited on 2016-03-29, released 2017-04-05
The last revision was dated 2019-01-02, with a file datestamp of 2018-12-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell wall assembly regulator SMI1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SMI1, KNR4, KTR4, YGR229C, G8553
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32566 (Start-267)
      • expression tag (268-274)
  • Chain 'B':
    Compound: Cell wall assembly regulator SMI1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SMI1, KNR4, KTR4, YGR229C, G8553
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32566 (Start-267)
      • expression tag (268)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5j1bA (A:)
    gplgshmstesndgvsetllawrhidfwtsehnpdlnatlsdpctqndithaeedlevsf
    pnpvkasfkihdgqedlesmtgtsglfygfqlmtldqvvamtqawrnvaknlnkrsqqgl
    shvtstgssssmerlngnkfklpnipdqksippnavqpvyahpawiplitdnagnhigvd
    lapgpngkyaqiitfgrdfdtkfviaenwgefllsfandleagnwylvddnddyfsgdge
    lvfrdkksngpiqdyfevlkrrtwikyqlerphrd
    

    Sequence, based on observed residues (ATOM records):
    >5j1bA (A:)
    ndgvsetllawrhidfwtsehnpdlnatlsdpctqndithaeedlevsfpnpvkasfkih
    dgqedtsglfygfqlmtldqvvamtqawrnvaknlnkrspdqksippnavqpvyahpawi
    plitdnagnhigvdlapgpngkyaqiitfgrdfdtkfviaenwgefllsfandleagnwy
    lvdgelvfrdkksngpiqdyfevlkrrtwikyqlerphrd
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5j1bB (B:)
    gplgshmstesndgvsetllawrhidfwtsehnpdlnatlsdpctqndithaeedlevsf
    pnpvkasfkihdgqedlesmtgtsglfygfqlmtldqvvamtqawrnvaknlnkrsqqgl
    shvtstgssssmerlngnkfklpnipdqksippnavqpvyahpawiplitdnagnhigvd
    lapgpngkyaqiitfgrdfdtkfviaenwgefllsfandleagnwylvddnddyfsgdge
    lvfrdkksngpiqdyfevlkrrtwikyqlerphrd
    

    Sequence, based on observed residues (ATOM records):
    >5j1bB (B:)
    ndgvsetllawrhidfwtsehnpdlnatlsdpctqndithaeedlevsfpnpvkasfkih
    dgqedlesmtgtsglfygfqlmtldqvvamtqawrnvaknlnkipdqksippnavqpvya
    hpawiplitdnagnhigvdlapgpngkyaqiitfgrdfdtkfviaenwgefllsfandle
    agnwylvdgelvfrdkksngpiqdyfevlkrrtwikyql