PDB entry 5j19

View 5j19 on RCSB PDB site
Description: phospho-pon binding-induced plk1 dimerization
Deposited on 2016-03-29, released 2016-06-15
The last revision was dated 2016-07-20, with a file datestamp of 2016-07-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase PLK1
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK1, PLK
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Serine/threonine-protein kinase PLK1
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK1, PLK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53350 (6-233)
      • expression tag (4-5)
  • Chain 'C':
    Compound: Phosphorylated peptide from Partner of Numb
    Species: DROSOPHILA MELANOGASTER, synthetic [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Phosphorylated peptide from Partner of Numb
    Species: DROSOPHILA MELANOGASTER, synthetic [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5j19A (A:)
    gpgsefgevvdchlsdmlqqlhsvnaskpserglvrqeeaedpacipifwvskwvdysdk
    yglgyqlcdnsvgvlfndstrlilyndgdslqyierdgtesyltvsshpnslmkkitllk
    yfrnymsehllkaganitpregdelarlpylrtwfrtrsaiilhlsngsvqinffqdhtk
    lilcplmaavtyidekrdfrtyrlslleeygcckelasrlryartmvdkllssr
    

    Sequence, based on observed residues (ATOM records):
    >5j19A (A:)
    dchlsdmlqqlhsvnaskpservrqeeaedpacipifwvskwvdysdkyglgyqlcdnsv
    gvlfndstrlilyndgdslqyierdgtesyltvsshpnslmkkitllkyfrnymsehllk
    aganitpregdelarlpylrtwfrtrsaiilhlsngsvqinffqdhtklilcplmaavty
    idekrdfrtyrlslleeygcckelasrlryartmvdkllss
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5j19B (B:)
    gpgsefgevvdchlsdmlqqlhsvnaskpserglvrqeeaedpacipifwvskwvdysdk
    yglgyqlcdnsvgvlfndstrlilyndgdslqyierdgtesyltvsshpnslmkkitllk
    yfrnymsehllkaganitpregdelarlpylrtwfrtrsaiilhlsngsvqinffqdhtk
    lilcplmaavtyidekrdfrtyrlslleeygcckelasrlryartmvdkllssr
    

    Sequence, based on observed residues (ATOM records):
    >5j19B (B:)
    efgevvdchlsdmlqqlhsvnaskpserglvrqeeaedpacipifwvskwvdysdkyglg
    yqlcdnsvgvlfndstrlilyndgdslqyierdgtesyltvsshpnslmkkitllkyfrn
    ymsehllkaganitpregdelarlpylrtwfrtrsaiilhlsngsvqinffqdhtklilc
    plmaavtyidekrdfrtyrlslleeygcckelasrlryartmvdkllssr
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5j19C (C:)
    escftnaafsstpkk
    

    Sequence, based on observed residues (ATOM records):
    >5j19C (C:)
    naafsstpk
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5j19D (D:)
    escftnaafsstpkk
    

    Sequence, based on observed residues (ATOM records):
    >5j19D (D:)
    aafsstpk