PDB entry 5j12

View 5j12 on RCSB PDB site
Description: structure of human tslp:tslpr in complex with mouse il-7ralpha
Deposited on 2016-03-28, released 2017-04-05
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 3.55 Å
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymic stromal lymphopoietin
    Species: Homo sapiens [TaxId:9606]
    Gene: Tslp
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q969D9 (Start-153)
      • engineered mutation (63)
      • expression tag (154-160)
  • Chain 'B':
    Compound: Interleukin-7 receptor subunit alpha
    Species: Mus musculus [TaxId:10090]
    Gene: IL7R
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Cytokine receptor-like factor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CRLF2, CRL2, ILXR, TSLPR
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5j12A (A:)
    mfpfallyvlsvsfrkifilqlvglvltydftncdfekikaaylstiskdlitymsgtks
    tefqntvscsnrphclteiqsltfnptagcaslakemfamktkaalaiwcpgysetqina
    tqamksvttnkcleqvsqlqglwrrfnrpllkqqgtkhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5j12A (A:)
    ydftncdfekikaaylstiskdlitymsgtkstefqntvscsnrphclteiqsltfnpta
    gcaslakemfamktkaalaiwcpgysetqinatttnkcleqvsqlqglwrrfnrpllkqq
    gtkhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5j12B (B:)
    gshmesgnaqdgdledadaddhsfwchsqlevdgsqhlltcafndsdintanlefqicga
    llrvkcltlnklqdiyfiktseflligssnicvklgqknltcknmaintivkaeapsdlk
    vvyrkeandflvtfnaphlkkkylkkvkhdvayrpargesnwthvslfhtrttipqrklr
    pkamyeikvrsiphndyfkgfwsewspsstfetpepknqggwd
    

    Sequence, based on observed residues (ATOM records):
    >5j12B (B:)
    hsfwchsqlevdgsqhlltcafndsdintanlefqicgallrvkcltlnklqdiyfikts
    eflligssnicvklgqknltcknmaintivkaeapsdlkvvyrkeandflvtfnaphlkk
    kylkkvkhdvayrpargesnwthvslfhtrttipqrklrpkamyeikvrsiphndyfkgf
    wsewspsstfetpe
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5j12C (C:)
    mgrlvllwgaavfllggwmalgqggaaegvqiqiiyfnletvqvtwnaskysrtnltfhy
    rfngdeaydqctnyllqeghtsgclldaeqrddilyfsirngthpvftasrwmvyylkps
    spkhvrfswhqdavtvtcsdlsygdllyevqyrspfdtewqskqentcnvtiegldaekc
    ysfwvrvkamedvygpdtypsdwsevtcwqrgeirdacaetgtkhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5j12C (C:)
    vqiqiiyfnletvqvtwnaskysrtnltfhyrfngdeaydqctnyllqeghtsgclldae
    qrddilyfsirngthpvftasrwmvyylkpsspkhvrfswhqdavtvtcsdlsygdllye
    vqyrspfdtewqskqentcnvtiegldaekcysfwvrvkamedvygpdtypsdwsevtcw
    qrgeirdac