PDB entry 5j0n

View 5j0n on RCSB PDB site
Description: lambda excision hj intermediate
Deposited on 2016-03-28, released 2017-02-08
The last revision was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: EM
Resolution: 11 Å
R-factor: N/A
AEROSPACI score: -0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: attP(-117 to +79)
    Species: Enterobacteria phage lambda, synthetic [TaxId:10710]
  • Chain 'B':
    Compound: attB(-21) to attP(+117)
    Species: Enterobacteria phage lambda, synthetic [TaxId:10710]
  • Chain 'C':
    Compound: attB(-19 to +21)
    Species: Escherichia coli, synthetic [TaxId:562]
  • Chain 'D':
    Compound: attP(-79) to attB(+19)
    Species: Enterobacteria phage lambda, synthetic [TaxId:10710]
  • Chain 'E':
    Compound: integrase
    Species: Enterobacteria phage lambda [TaxId:10710]
    Gene: INT
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: integrase
    Species: Enterobacteria phage lambda [TaxId:10710]
    Gene: INT
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: integrase
    Species: Enterobacteria phage lambda [TaxId:10710]
    Gene: INT
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: integrase
    Species: Enterobacteria phage lambda [TaxId:10710]
    Gene: INT
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Integration host factor subunit alpha
    Species: Escherichia coli [TaxId:562]
    Gene: ihfA, himA, ECS88_1763
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Integration host factor subunit beta
    Species: Escherichia coli [TaxId:562]
    Gene: ihfB, himD, ECS88_0940
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Integration host factor subunit alpha
    Species: Escherichia coli [TaxId:562]
    Gene: ihfA, himA, ECS88_1763
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Integration host factor subunit beta
    Species: Escherichia coli [TaxId:562]
    Gene: ihfB, himD, ECS88_0940
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Excisionase
    Species: Enterobacteria phage lambda [TaxId:10710]
    Gene: Xis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03699 (0-End)
      • conflict (27)
  • Chain 'N':
    Compound: Excisionase
    Species: Enterobacteria phage lambda [TaxId:10710]
    Gene: Xis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03699 (0-End)
      • conflict (27)
  • Chain 'O':
    Compound: Excisionase
    Species: Enterobacteria phage lambda [TaxId:10710]
    Gene: Xis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03699 (0-54)
      • conflict (27)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5j0nE (E:)
    mgrrrsherrdlppnlyirnngyycyrdprtgkefglgrdrriaiteaiqanielfsghk
    hkpltarinsdnsvtlhswldryekilasrgikqktlinymskikairrglpdapledit
    tkeiaamlngyidegkaasaklirstlsdafreaiaeghittnhvaatraaksevrrsrl
    tadeylkiyqaaesspcwlrlamelavvtgqrvgdlcemkwsdivdgylyveqsktgvki
    aiptalhidalgismketldkckeilggetiiastrreplssgtvsryfmrarkasglsf
    egdpptfhelrslsarlyekqisdkfaqhllghksdtmasqyrddrgrewdkieik
    

    Sequence, based on observed residues (ATOM records):
    >5j0nE (E:)
    nsvtlhswldryekilasrgikqktlinymskikairrglpdapledittkeiaamlngy
    idegkaasaklirstlsdafreaiaeghittnhvaatraaksevrrsrltadeylkiyqa
    aesspcwlrlamelavvtgqrvgdlcemkwsdivdgylyveqsktgvkiaiptalhidal
    gismketldkckeilggetiiastrreplssgtvsryfmrarkasglsfegdpptfhelr
    slsarlyekqisdkfaqhllghksdtewdkieik
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records:
    >5j0nF (F:)
    mgrrrsherrdlppnlyirnngyycyrdprtgkefglgrdrriaiteaiqanielfsghk
    hkpltarinsdnsvtlhswldryekilasrgikqktlinymskikairrglpdapledit
    tkeiaamlngyidegkaasaklirstlsdafreaiaeghittnhvaatraaksevrrsrl
    tadeylkiyqaaesspcwlrlamelavvtgqrvgdlcemkwsdivdgylyveqsktgvki
    aiptalhidalgismketldkckeilggetiiastrreplssgtvsryfmrarkasglsf
    egdpptfhelrslsarlyekqisdkfaqhllghksdtmasqyrddrgrewdkieik
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5j0nG (G:)
    mgrrrsherrdlppnlyirnngyycyrdprtgkefglgrdrriaiteaiqanielfsghk
    hkpltarinsdnsvtlhswldryekilasrgikqktlinymskikairrglpdapledit
    tkeiaamlngyidegkaasaklirstlsdafreaiaeghittnhvaatraaksevrrsrl
    tadeylkiyqaaesspcwlrlamelavvtgqrvgdlcemkwsdivdgylyveqsktgvki
    aiptalhidalgismketldkckeilggetiiastrreplssgtvsryfmrarkasglsf
    egdpptfhelrslsarlyekqisdkfaqhllghksdtmasqyrddrgrewdkieik
    

    Sequence, based on observed residues (ATOM records):
    >5j0nG (G:)
    mgrrrsherrdlppnlyirnngyycyrdprtgkefglgrdrriaiteaiqanielfsghk
    hkpltarinsdnsvtlhswldryekilasrgikqktlinymskikairrglpdapledit
    tkeiaamlngyidegkaasaklirstlsdafreaiaeghittnhvaatraaksevrrsrl
    tadeylkiyqaaesspcwlrlamelavvtgqrvgdlcemkwsdivdgylyveqsktgvki
    aiptalhidalgismketldkckeilggetiiastrreplssgtvsryfmrarkasglsf
    egdpptfhelrslsarlyekqisdkfaqhllghksdtewdkieik
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records:
    >5j0nH (H:)
    mgrrrsherrdlppnlyirnngyycyrdprtgkefglgrdrriaiteaiqanielfsghk
    hkpltarinsdnsvtlhswldryekilasrgikqktlinymskikairrglpdapledit
    tkeiaamlngyidegkaasaklirstlsdafreaiaeghittnhvaatraaksevrrsrl
    tadeylkiyqaaesspcwlrlamelavvtgqrvgdlcemkwsdivdgylyveqsktgvki
    aiptalhidalgismketldkckeilggetiiastrreplssgtvsryfmrarkasglsf
    egdpptfhelrslsarlyekqisdkfaqhllghksdtmasqyrddrgrewdkieik
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records:
    >5j0nI (I:)
    altkaemseylfdklglskrdakelvelffeeirralengeqvklsgfgnfdlrdknqrp
    grnpktgedipitarrvvtfrpgqklksrvenaspk
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records:
    >5j0nJ (J:)
    mtkselierlatqqshipaktvedavkemlehmastlaqgerieirgfgsfslhyraprt
    grnpktgdkvelegkyvphfkpgkelrdraniyg
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records:
    >5j0nK (K:)
    altkaemseylfdklglskrdakelvelffeeirralengeqvklsgfgnfdlrdknqrp
    grnpktgedipitarrvvtfrpgqklksrvenaspk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records:
    >5j0nL (L:)
    mtkselierlatqqshipaktvedavkemlehmastlaqgerieirgfgsfslhyraprt
    grnpktgdkvelegkyvphfkpgkelrdraniyg
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >5j0nM (M:)
    myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdlnrp
    

    Sequence, based on observed residues (ATOM records):
    >5j0nM (M:)
    myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdln
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >5j0nN (N:)
    myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdlnrp
    

    Sequence, based on observed residues (ATOM records):
    >5j0nN (N:)
    myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdlnr
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records:
    >5j0nO (O:)
    myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdlnrp