PDB entry 5j0g

View 5j0g on RCSB PDB site
Description: monomeric human cu,zn superoxide dismutase, loops iv and vii deleted, apo form, circular permutant p7/8
Deposited on 2016-03-28, released 2017-02-01
The last revision was dated 2018-01-17, with a file datestamp of 2018-01-12.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: OXIDOREDUCTASE,Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • PDB 5J0G (0-13)
      • linker (14-17)
    • Uniprot P00441 (18-110)
      • conflict (23)
      • conflict (66-67)
      • conflict (98)
      • expression tag (111-112)
  • Chain 'B':
    Compound: OXIDOREDUCTASE,Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • PDB 5J0G (0-13)
      • linker (14-17)
    • Uniprot P00441 (18-110)
      • conflict (23)
      • conflict (66-67)
      • conflict (98)
      • expression tag (111-112)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5j0gA (A:)
    agsrlasgvigiaqagagatkavavlkgdgpvqgiinfeqkesngpvkvwgsikgltegl
    hgfhvhgaggdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvhekaga
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >5j0gB (B:)
    agsrlasgvigiaqagagatkavavlkgdgpvqgiinfeqkesngpvkvwgsikgltegl
    hgfhvhgaggdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvhekaga