PDB entry 5izw

View 5izw on RCSB PDB site
Description: crystal structure of rna editing specific factor of designer pls-type ppr-9r protein
Deposited on 2016-03-26, released 2017-03-29
The last revision was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.7400000000000002 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pls9-ppr
    Species: unidentified [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IZW
  • Chain 'B':
    Compound: pls9-ppr
    Species: unidentified [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IZW (0-100)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5izwA (A:)
    vvtyntlidglckagkldealklfeemvekgikpdeftfssvlkacarlgalelgkqihg
    yviksgfesnvvvynalidmyskcglleearkvfdempekd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >5izwB (B:)
    vvtyntlidglckagkldealklfeemvekgikpdeftfssvlkacarlgalelgkqihg
    yviksgfesnvvvynalidmyskcglleearkvfdempekd