PDB entry 5izm

View 5izm on RCSB PDB site
Description: the crystal structure of human eefsec in complex with gdpnp
Deposited on 2016-03-25, released 2016-10-12
The last revision was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Selenocysteine-specific elongation factor
    Species: Homo sapiens [TaxId:9606]
    Gene: EEFSEC, SELB
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Selenocysteine-specific elongation factor
    Species: Homo sapiens [TaxId:9606]
    Gene: EEFSEC, SELB
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MN, GNP

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5izmA (A:)
    mgsshhhhhhssglvprgshmagrrvnvnvgvlghidsgktalaralsttastaafdkqp
    qsrergitldlgfscfsvplparlrsslpefqaapeaepepgepllqvtlvdcpghasli
    rtiiggaqiidlmmlvidvtkgmqtqsaeclvigqiacqklvvvlnkidllpegkrqaai
    dkmtkkmqktlentkfrgapiipvaakpggpeapeteapqgipelielltsqisiptrdp
    sgpflmsvdhcfsikgqgtvmtgtilsgsislgdsveipalkvvkkvksmqmfhmpitsa
    mqgdrlgicvtqfdpkllerglvcapeslhtvhaalisvekipyfrgplqtkakfhitvg
    hetvmgrlmffspapdnfdqepildsfnfsqeylfqeqylskdltpavtdndeadkkagq
    ateghcprqqwalvefekpvtcprlclvigsrldadihtntcrlafhgillhgledrnya
    dsflprlkvyklkhkhglveramddysvigrslfkketniqlfvglkvhlstgelgiids
    afgqsgkfkihipgglspeskkiltpalkkraragrgeatrqeesaersepsqhvvlslt
    fkryvfdthkrmvqsp
    

    Sequence, based on observed residues (ATOM records):
    >5izmA (A:)
    grrvnvnvgvlghidsgktalaralsttaitldlgfscfsvplparlrsspllqvtlvdc
    pghaslirtiiggaqiidlmmlvidvtkgmqtqsaeclvigqiacqklvvvlnkidllpe
    gkrqaaidkmtkkmqktlentkfrgapiipvaakpggapqgipelielltsqisiptrdp
    sgpflmsvdhcfsigtvmtgtilsgsislgdsveipalkvvkkvksmqmfhmpitsamqg
    drlgicvtqfdpkllerglvcapeslhtvhaalisvekipyfrgplqtkakfhitvghet
    vmgrlmffspapdnfdqepildsfnfsqeylfqeqylsprqqwalvefekpvtcprlclv
    igsrldadihtntcrlafhgillhgledrnyadsflprlkvyklkhkddysvqlfvglkv
    hlstgelgiidsfkihipggllsltfkryvfdthkrmvqs
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5izmB (B:)
    mgsshhhhhhssglvprgshmagrrvnvnvgvlghidsgktalaralsttastaafdkqp
    qsrergitldlgfscfsvplparlrsslpefqaapeaepepgepllqvtlvdcpghasli
    rtiiggaqiidlmmlvidvtkgmqtqsaeclvigqiacqklvvvlnkidllpegkrqaai
    dkmtkkmqktlentkfrgapiipvaakpggpeapeteapqgipelielltsqisiptrdp
    sgpflmsvdhcfsikgqgtvmtgtilsgsislgdsveipalkvvkkvksmqmfhmpitsa
    mqgdrlgicvtqfdpkllerglvcapeslhtvhaalisvekipyfrgplqtkakfhitvg
    hetvmgrlmffspapdnfdqepildsfnfsqeylfqeqylskdltpavtdndeadkkagq
    ateghcprqqwalvefekpvtcprlclvigsrldadihtntcrlafhgillhgledrnya
    dsflprlkvyklkhkhglveramddysvigrslfkketniqlfvglkvhlstgelgiids
    afgqsgkfkihipgglspeskkiltpalkkraragrgeatrqeesaersepsqhvvlslt
    fkryvfdthkrmvqsp
    

    Sequence, based on observed residues (ATOM records):
    >5izmB (B:)
    rrvnvnvgvlghidsgktalaralsttagitldlgfscfsvplparlrsslepllqvtlv
    dcpghaslirtiiggaqiidlmmlvidvtkgmqtqsaeclvigqiacqklvvvlnkidll
    perqaaidkmtkkmqktlentkfrgapiipvaakpggpqgipelielltsqisiptrdps
    gpflmsvdhcfsikgqgtvmtgtilsgsislgdsveipalkvvkkvksmqmfhmpitsam
    qgdrlgicvtqfdpkllerglvcapeslhtvhaalisvekipyfrgplqtkakfhitvgh
    etvmgrlmffspapdnfdqepildsfnfsqeylfqeqylsprqqwalvefekpvtcprlc
    lvigsrldahtntcrlafhgillhgledrnyadsflprlkvyklkhkhglveramddysv
    igrslfetniqlfvglkvhlstgelgiidsafgkfkihipgglspeskkilsqhvvlslt
    fkryvfdthkrmvqs