PDB entry 5izd

View 5izd on RCSB PDB site
Description: Wild-type glyceraldehyde dehydrogenase from Thermoplasma acidophilum in complex with NADP
Class: oxidoreductase
Keywords: oxidoreductase, NADP-dependent dehydrogenase
Deposited on 2016-03-25, released 2017-04-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-glyceraldehyde dehydrogenase (NADP(+))
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: Ta0809
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HK01 (0-492)
      • expression tag (493)
    Domains in SCOPe 2.08: d5izda1, d5izda2
  • Chain 'B':
    Compound: D-glyceraldehyde dehydrogenase (NADP(+))
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: Ta0809
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5izdb_
  • Chain 'C':
    Compound: D-glyceraldehyde dehydrogenase (NADP(+))
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: Ta0809
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5izdc_
  • Chain 'D':
    Compound: D-glyceraldehyde dehydrogenase (NADP(+))
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: Ta0809
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5izdd_
  • Chain 'E':
    Compound: D-glyceraldehyde dehydrogenase (NADP(+))
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: Ta0809
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5izde_
  • Chain 'F':
    Compound: D-glyceraldehyde dehydrogenase (NADP(+))
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: Ta0809
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5izdf_
  • Chain 'G':
    Compound: D-glyceraldehyde dehydrogenase (NADP(+))
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: Ta0809
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5izdg_
  • Chain 'H':
    Compound: D-glyceraldehyde dehydrogenase (NADP(+))
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: Ta0809
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5izdh_
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5izdA (A:)
    mdtklyidgqwvnsssgktvdkyspvtgqvigrfeaatrddvdraidaaedafwawndlg
    sverskiiyrakelieknraeleniimeengkpvkeakeevdgvidqiqyyaewarklng
    evvegtsshrkifqykvpygivvaltpwnfpagmvarklapalltgntvvlkpssdtpgs
    aewivrkfveagvpkgvlnfitgrgseigdyivehkkvnlitmtgstatgqrimqkasan
    maklilelggkapfmvwkdadmdnalktllwakywnagqsciaaerlyvhediydtfmsr
    fvelsrklalgdpknadmgplinkgalqatseiveeakesgakilfggsqpslsgpyrng
    yfflptiignadqkskifqeeifapvigarkissveemydlandskyglasylftkdpni
    ifeaserirfgelyvnmpgpeasqgyhtgfrmtgqagegskygiseylklkniyvdysgk
    plhintvrddlfqsgrpvlgsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5izdA (A:)
    mdtklyidgqwvnsssgktvdkyspvtgqvigrfeaatrddvdraidaaedafwawndlg
    sverskiiyrakelieknraeleniimeengkpvkeakeevdgvidqiqyyaewarklng
    evvegtsshrkifqykvpygivvaltpwnfpagmvarklapalltgntvvlkpssdtpgs
    aewivrkfveagvpkgvlnfitgrgseigdyivehkkvnlitmtgstatgqrimqkasan
    maklilelggkapfmvwkdadmdnalktllwakywnagqsciaaerlyvhediydtfmsr
    fvelsrklalgdpknadmgplinkgalqatseiveeakesgakilfggsqpslsgpyrng
    yfflptiignadqkskifqeeifapvigarkissveemydlandskyglasylftkdpni
    ifeaserirfgelyvnmpgpeasqgyhtgfrmtgqagegskygiseylklkniyvdysgk
    plhintvrddlfqs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5izdB (B:)
    mdtklyidgqwvnsssgktvdkyspvtgqvigrfeaatrddvdraidaaedafwawndlg
    sverskiiyrakelieknraeleniimeengkpvkeakeevdgvidqiqyyaewarklng
    evvegtsshrkifqykvpygivvaltpwnfpagmvarklapalltgntvvlkpssdtpgs
    aewivrkfveagvpkgvlnfitgrgseigdyivehkkvnlitmtgstatgqrimqkasan
    maklilelggkapfmvwkdadmdnalktllwakywnagqsciaaerlyvhediydtfmsr
    fvelsrklalgdpknadmgplinkgalqatseiveeakesgakilfggsqpslsgpyrng
    yfflptiignadqkskifqeeifapvigarkissveemydlandskyglasylftkdpni
    ifeaserirfgelyvnmpgpeasqgyhtgfrmtgqagegskygiseylklkniyvdysgk
    plhintvrddlfqsgrpvlgsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5izdB (B:)
    mdtklyidgqwvnsssgktvdkyspvtgqvigrfeaatrddvdraidaaedafwawndlg
    sverskiiyrakelieknraeleniimeengkpvkeakeevdgvidqiqyyaewarklng
    evvegtsshrkifqykvpygivvaltpwnfpagmvarklapalltgntvvlkpssdtpgs
    aewivrkfveagvpkgvlnfitgrgseigdyivehkkvnlitmtgstatgqrimqkasan
    maklilelggkapfmvwkdadmdnalktllwakywnagqsciaaerlyvhediydtfmsr
    fvelsrklalgdpknadmgplinkgalqatseiveeakesgakilfggsqpslsgpyrng
    yfflptiignadqkskifqeeifapvigarkissveemydlandskyglasylftkdpni
    ifeaserirfgelyvnmpgpeasqgyhtgfrmtgqagegskygiseylklkniyvdysgk
    plhintvrddlf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5izdC (C:)
    mdtklyidgqwvnsssgktvdkyspvtgqvigrfeaatrddvdraidaaedafwawndlg
    sverskiiyrakelieknraeleniimeengkpvkeakeevdgvidqiqyyaewarklng
    evvegtsshrkifqykvpygivvaltpwnfpagmvarklapalltgntvvlkpssdtpgs
    aewivrkfveagvpkgvlnfitgrgseigdyivehkkvnlitmtgstatgqrimqkasan
    maklilelggkapfmvwkdadmdnalktllwakywnagqsciaaerlyvhediydtfmsr
    fvelsrklalgdpknadmgplinkgalqatseiveeakesgakilfggsqpslsgpyrng
    yfflptiignadqkskifqeeifapvigarkissveemydlandskyglasylftkdpni
    ifeaserirfgelyvnmpgpeasqgyhtgfrmtgqagegskygiseylklkniyvdysgk
    plhintvrddlfqsgrpvlgsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5izdC (C:)
    mdtklyidgqwvnsssgktvdkyspvtgqvigrfeaatrddvdraidaaedafwawndlg
    sverskiiyrakelieknraeleniimeengkpvkeakeevdgvidqiqyyaewarklng
    evvegtsshrkifqykvpygivvaltpwnfpagmvarklapalltgntvvlkpssdtpgs
    aewivrkfveagvpkgvlnfitgrgseigdyivehkkvnlitmtgstatgqrimqkasan
    maklilelggkapfmvwkdadmdnalktllwakywnagqsciaaerlyvhediydtfmsr
    fvelsrklalgdpknadmgplinkgalqatseiveeakesgakilfggsqprngyfflpt
    iigdqkskifqeeifapvigarkissveemydlandskyglasylftkdpniifeaseri
    rfgelyvnmpgpeasqgyhtgfrmtgqagegskygiseylklkniyvdysgkplhintvr
    ddlf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5izdD (D:)
    mdtklyidgqwvnsssgktvdkyspvtgqvigrfeaatrddvdraidaaedafwawndlg
    sverskiiyrakelieknraeleniimeengkpvkeakeevdgvidqiqyyaewarklng
    evvegtsshrkifqykvpygivvaltpwnfpagmvarklapalltgntvvlkpssdtpgs
    aewivrkfveagvpkgvlnfitgrgseigdyivehkkvnlitmtgstatgqrimqkasan
    maklilelggkapfmvwkdadmdnalktllwakywnagqsciaaerlyvhediydtfmsr
    fvelsrklalgdpknadmgplinkgalqatseiveeakesgakilfggsqpslsgpyrng
    yfflptiignadqkskifqeeifapvigarkissveemydlandskyglasylftkdpni
    ifeaserirfgelyvnmpgpeasqgyhtgfrmtgqagegskygiseylklkniyvdysgk
    plhintvrddlfqsgrpvlgsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5izdD (D:)
    mdtklyidgqwvnsssgktvdkyspvtgqvigrfeaatrddvdraidaaedafwawndlg
    sverskiiyrakelieknraeleniimeengkpvkeakeevdgvidqiqyyaewarklng
    evvegtsshrkifqykvpygivvaltpwnfpagmvarklapalltgntvvlkpssdtpgs
    aewivrkfveagvpkgvlnfitgrgseigdyivehkkvnlitmtgstatgqrimqkasan
    maklilelggkapfmvwkdadmdnalktllwakywnagqsciaaerlyvhediydtfmsr
    fvelsrklalgdpknadmgplinkgalqatseiveeakesgakilfggsqpyrngyfflp
    tiignadqkskifqeeifapvigarkissveemydlandskyglasylftkdpniifeas
    erirfgelyvnmpgpeasqgyhtgfrmtgqagegskygiseylklkniyvdysgkplhin
    tvrddlf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5izdE (E:)
    mdtklyidgqwvnsssgktvdkyspvtgqvigrfeaatrddvdraidaaedafwawndlg
    sverskiiyrakelieknraeleniimeengkpvkeakeevdgvidqiqyyaewarklng
    evvegtsshrkifqykvpygivvaltpwnfpagmvarklapalltgntvvlkpssdtpgs
    aewivrkfveagvpkgvlnfitgrgseigdyivehkkvnlitmtgstatgqrimqkasan
    maklilelggkapfmvwkdadmdnalktllwakywnagqsciaaerlyvhediydtfmsr
    fvelsrklalgdpknadmgplinkgalqatseiveeakesgakilfggsqpslsgpyrng
    yfflptiignadqkskifqeeifapvigarkissveemydlandskyglasylftkdpni
    ifeaserirfgelyvnmpgpeasqgyhtgfrmtgqagegskygiseylklkniyvdysgk
    plhintvrddlfqsgrpvlgsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5izdE (E:)
    mdtklyidgqwvnsssgktvdkyspvtgqvigrfeaatrddvdraidaaedafwawndlg
    sverskiiyrakelieknraeleniimeengkpvkeakeevdgvidqiqyyaewarklng
    evvegtsshrkifqykvpygivvaltpwnfpagmvarklapalltgntvvlkpssdtpgs
    aewivrkfveagvpkgvlnfitgrgseigdyivehkkvnlitmtgstatgqrimqkasan
    maklilelggkapfmvwkdadmdnalktllwakywnagqsciaaerlyvhediydtfmsr
    fvelsrklalgdpknadmgplinkgalqatseiveeakesgakilfggsqpslsgpyrng
    yfflptiignadqkskifqeeifapvigarkissveemydlandskyglasylftkdpni
    ifeaserirfgelyvnmpgpeasqgyhtgfrmtgqagegskygiseylklkniyvdysgk
    plhintvrddlf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5izdF (F:)
    mdtklyidgqwvnsssgktvdkyspvtgqvigrfeaatrddvdraidaaedafwawndlg
    sverskiiyrakelieknraeleniimeengkpvkeakeevdgvidqiqyyaewarklng
    evvegtsshrkifqykvpygivvaltpwnfpagmvarklapalltgntvvlkpssdtpgs
    aewivrkfveagvpkgvlnfitgrgseigdyivehkkvnlitmtgstatgqrimqkasan
    maklilelggkapfmvwkdadmdnalktllwakywnagqsciaaerlyvhediydtfmsr
    fvelsrklalgdpknadmgplinkgalqatseiveeakesgakilfggsqpslsgpyrng
    yfflptiignadqkskifqeeifapvigarkissveemydlandskyglasylftkdpni
    ifeaserirfgelyvnmpgpeasqgyhtgfrmtgqagegskygiseylklkniyvdysgk
    plhintvrddlfqsgrpvlgsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5izdF (F:)
    mdtklyidgqwvnsssgktvdkyspvtgqvigrfeaatrddvdraidaaedafwawndlg
    sverskiiyrakelieknraeleniimeengkpvkeakeevdgvidqiqyyaewarklng
    evvegtsshrkifqykvpygivvaltpwnfpagmvarklapalltgntvvlkpssdtpgs
    aewivrkfveagvpkgvlnfitgrgseigdyivehkkvnlitmtgstatgqrimqkasan
    maklilelggkapfmvwkdadmdnalktllwakywnagqsciaaerlyvhediydtfmsr
    fvelsrklalgdpknadmgplinkgalqatseiveeakesgakilfggsqpslsgpyrng
    yfflptiignadqkskifqeeifapvigarkissveemydlandskyglasylftkdpni
    ifeaserirfgelyvnmpgpeasqgyhtgfrmtgqagegskygiseylklkniyvdysgk
    plhintvrddlf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5izdG (G:)
    mdtklyidgqwvnsssgktvdkyspvtgqvigrfeaatrddvdraidaaedafwawndlg
    sverskiiyrakelieknraeleniimeengkpvkeakeevdgvidqiqyyaewarklng
    evvegtsshrkifqykvpygivvaltpwnfpagmvarklapalltgntvvlkpssdtpgs
    aewivrkfveagvpkgvlnfitgrgseigdyivehkkvnlitmtgstatgqrimqkasan
    maklilelggkapfmvwkdadmdnalktllwakywnagqsciaaerlyvhediydtfmsr
    fvelsrklalgdpknadmgplinkgalqatseiveeakesgakilfggsqpslsgpyrng
    yfflptiignadqkskifqeeifapvigarkissveemydlandskyglasylftkdpni
    ifeaserirfgelyvnmpgpeasqgyhtgfrmtgqagegskygiseylklkniyvdysgk
    plhintvrddlfqsgrpvlgsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5izdG (G:)
    mdtklyidgqwvnsssgktvdkyspvtgqvigrfeaatrddvdraidaaedafwawndlg
    sverskiiyrakelieknraeleniimeengkpvkeakeevdgvidqiqyyaewarklng
    evvegtsshrkifqykvpygivvaltpwnfpagmvarklapalltgntvvlkpssdtpgs
    aewivrkfveagvpkgvlnfitgrgseigdyivehkkvnlitmtgstatgqrimqkasan
    maklilelggkapfmvwkdadmdnalktllwakywnagqsciaaerlyvhediydtfmsr
    fvelsrklalgdpknadmgplinkgalqatseiveeakesgakilfggsqpslsgpyrng
    yfflptiignadqkskifqeeifapvigarkissveemydlandskyglasylftkdpni
    ifeaserirfgelyvnmpgpeasqgyhtgfrmtgqagegskygiseylklkniyvdysgk
    plhintvrddlf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5izdH (H:)
    mdtklyidgqwvnsssgktvdkyspvtgqvigrfeaatrddvdraidaaedafwawndlg
    sverskiiyrakelieknraeleniimeengkpvkeakeevdgvidqiqyyaewarklng
    evvegtsshrkifqykvpygivvaltpwnfpagmvarklapalltgntvvlkpssdtpgs
    aewivrkfveagvpkgvlnfitgrgseigdyivehkkvnlitmtgstatgqrimqkasan
    maklilelggkapfmvwkdadmdnalktllwakywnagqsciaaerlyvhediydtfmsr
    fvelsrklalgdpknadmgplinkgalqatseiveeakesgakilfggsqpslsgpyrng
    yfflptiignadqkskifqeeifapvigarkissveemydlandskyglasylftkdpni
    ifeaserirfgelyvnmpgpeasqgyhtgfrmtgqagegskygiseylklkniyvdysgk
    plhintvrddlfqsgrpvlgsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5izdH (H:)
    mdtklyidgqwvnsssgktvdkyspvtgqvigrfeaatrddvdraidaaedafwawndlg
    sverskiiyrakelieknraeleniimeengkpvkeakeevdgvidqiqyyaewarklng
    evvegtsshrkifqykvpygivvaltpwnfpagmvarklapalltgntvvlkpssdtpgs
    aewivrkfveagvpkgvlnfitgrgseigdyivehkkvnlitmtgstatgqrimqkasan
    maklilelggkapfmvwkdadmdnalktllwakywnagqsciaaerlyvhediydtfmsr
    fvelsrklalgdpknadmgplinkgalqatseiveeakesgakilfggsqpslsgpyrng
    yfflptiignadqkskifqeeifapvigarkissveemydlandskyglasylftkdpni
    ifeaserirfgelyvnmpgpeasqgyhtgfrmtgqagegskygiseylklkniyvdysgk
    plhintvrddlf