PDB entry 5izb

View 5izb on RCSB PDB site
Description: Murin CXCL13 solution structure featuring a folded N-terminal domain
Class: signaling protein
Keywords: Chemokine structure N-terminal domain conformational exchange, Signaling protein
Deposited on 2016-03-25, released 2017-04-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-X-C motif chemokine 13
    Species: Mus musculus [TaxId:10090]
    Gene: Cxcl13, Blc, Scyb13
    Database cross-references and differences (RAF-indexed):
    • Uniprot O55038 (1-88)
      • initiating methionine (0)
    Domains in SCOPe 2.08: d5izba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5izbA (A:)
    mileahytnlkcrcsgvistvvglniidriqvtppgngcpktevviwtkmkkvicvnpra
    kwlqrllrhvqskslsstpqapvskrraa