PDB entry 5iz4

View 5iz4 on RCSB PDB site
Description: Crystal structure of a putative short-chain dehydrogenase/reductase from Burkholderia xenovorans
Class: oxidoreductase
Keywords: SSGCID, Burkholderia xenovorans, short-chain dehydrogenase/reductase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, OXIDOREDUCTASE
Deposited on 2016-03-24, released 2016-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative short-chain dehydrogenase/reductase
    Species: Burkholderia xenovorans (strain LB400) [TaxId:266265]
    Gene: Bxe_C0900
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5iz4a_
  • Heterogens: ADP, MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5iz4A (A:)
    mahhhhhhmtqsstpvcvitgsasgigaatalrfaqagwsvaignfddstrdaastveal
    crdagaqtlifdadvgkdadcrhavdmvasrwqridalincagttrviphnafdqiddfe
    fervyrvnliglyqmtraavpllresasatrstsvvnvsslaglngtgssiayaaskgav
    ntltlslarnlaphirvnalapgmvddglllrvldaaaydgvlsrmtesaplkrvsrpae
    iaelawfltahapaitgqviaaenglllgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iz4A (A:)
    qsstpvcvitgsasgigaatalrfaqagwsvaignfddstrdaastvealcrdagaqtli
    fdadvgkdadcrhavdmvasrwqridalincagttrviphnafdqiddfefervyrvnli
    glyqmtraavpllresasatrstsvvnvsslaglngtgssiayaaskgavntltlslarn
    laphirvnalapgmvddggvlsrmtesaplkrvsrpaeiaelawfltahapaitgqviaa
    englllg