PDB entry 5iyv

View 5iyv on RCSB PDB site
Description: crystal structure of the arabidopsis receptor kinase haesa lrr ectdomain in complex with the peptide hormone idl1.
Deposited on 2016-03-24, released 2016-04-20
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Receptor-like protein kinase 5
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: RLK5, HAE, At4g28490, F21O9.180
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47735 (5-End)
      • expression tag (3-4)
  • Chain 'B':
    Compound: Protein IDA-LIKE 1
    Species: ARABIDOPSIS THALIANA, synthetic [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5iyvA (A:)
    gssmgslnqdatilrqaklglsdpaqslsswsdnndvtpckwlgvscdatsnvvsvdlss
    fmlvgpfpsilchlpslhslslynnsingslsaddfdtchnlisldlsenllvgsipksl
    pfnlpnlkfleisgnnlsdtipssfgefrkleslnlagnflsgtipaslgnvttlkelkl
    aynlfspsqipsqlgnltelqvlwlagcnlvgpippslsrltslvnldltfnqltgsips
    witqlktveqielfnnsfsgelpesmgnmttlkrfdasmnkltgkipdnlnllnleslnl
    fenmlegplpesitrsktlselklfnnrltgvlpsqlgansplqyvdlsynrfsgeipan
    vcgegkleylilidnsfsgeisnnlgkcksltrvrlsnnklsgqiphgfwglprlsllel
    sdnsftgsipktiigaknlsnlrisknrfsgsipneigslngiieisgaendfsgeipes
    lvklkqlsrldlsknqlsgeiprelrgwknlnelnlannhlsgeipkevgilpvlnyldl
    ssnqfsgeiplelqnlklnvlnlsynhlsgkipplyankiyahdfignpglcvdldglcr
    kitrsklegsenlyfq
    

    Sequence, based on observed residues (ATOM records):
    >5iyvA (A:)
    mgslnqdatilrqaklglsdpaqslsswsdvtpckwlgvscdatsnvvsvdlssfmlvgp
    fpsilchlpslhslslynnsingslsaddfdtchnlisldlsenllvgsipkslpfnlpn
    lkfleisgnnlsdtipssfgefrkleslnlagnflsgtipaslgnvttlkelklaynlfs
    psqipsqlgnltelqvlwlagcnlvgpippslsrltslvnldltfnqltgsipswitqlk
    tveqielfnnsfsgelpesmgnmttlkrfdasmnkltgkipdnlnllnleslnlfenmle
    gplpesitrsktlselklfnnrltgvlpsqlgansplqyvdlsynrfsgeipanvcgegk
    leylilidnsfsgeisnnlgkcksltrvrlsnnklsgqiphgfwglprlsllelsdnsft
    gsipktiigaknlsnlrisknrfsgsipneigslngiieisgaendfsgeipeslvklkq
    lsrldlsknqlsgeiprelrgwknlnelnlannhlsgeipkevgilpvlnyldlssnqfs
    geiplelqnlklnvlnlsynhlsgkipplyankiyahdfignpglcvd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >5iyvB (B:)
    lvppsgpsmrhn