PDB entry 5iys

View 5iys on RCSB PDB site
Description: crystal structure of a dehydrosqualene synthase in complex with ligand
Deposited on 2016-03-24, released 2017-03-29
The last revision was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phytoene synthase
    Species: Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258), synthetic [TaxId:768486]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, MG, FPS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5iysA (A:)
    mitinndpfqeyqkdfaycesiikknsksfylafsqlpkrkaqsvyavyafcrraddlid
    rdnnqaglrqlerqlldfnegkvpndpvwralsvvfdnfpmvtapffdmltgqrkdadfk
    qpetrkdleeycyyvagsvglmllpllterpadivvpakklgeamqltnilrdvgedyqm
    griyltkedmtrfgvattmlkekqaqtqlvalweslakqaenlyeesfemfplitedcrq
    alasaafiyreqlnivrkqhyslfdnknkvshyrkvqllkevksylksy
    

    Sequence, based on observed residues (ATOM records):
    >5iysA (A:)
    dpfqeyqkdfaycesiikknsksfylafsqlpkrkaqsvyavyafcrraddlidrdnnqa
    glrqlerqlldfnegkvpndpvwralsvvfdnfpmvtapffdmltgqrkdadfkqpetrk
    dleeycyyvagsvglmllpllterpadivvpakklgeamqltnilrdvgedyqmgriylt
    kedmtrfgvattmlkekqaqtqlvalweslakqaenlyeesfemfplitedcrqalasaa
    fiyreqlnivrkqhyslfdnknkvshyrkvqllkevksylksy