PDB entry 5iyq

View 5iyq on RCSB PDB site
Description: protruding domain of gii.4 human norovirus chdc2094 in complex with hbga type b (triglycan)
Deposited on 2016-03-24, released 2017-04-05
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.41 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protruding domain of GII.4 norovirus CHDC2094 capsid
    Species: Norovirus Hu/GII.4/CHDC2094/1974/US [TaxId:660656]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Protruding domain of GII.4 norovirus CHDC2094 capsid
    Species: Norovirus Hu/GII.4/CHDC2094/1974/US [TaxId:660656]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, FLC, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5iyqA (A:)
    kpftvpiltveemsnsrfpipleklytgpssafvvqpqngrcttdgvllgttqlsavnic
    nfrgdvtrvgishdytmnlvsqnwnnydpteeipaplgtpdfvgkiqglltqttradgst
    rahkatvstgsvhftpklgsvqfttdtnndfqtgqntkftpvgviqdgdhhqnepqqwvl
    pnysgtsghnvhlapavaptfpgeqllffrstmpgcsgypnmnldcllpqewvshfyqea
    apaqsdvallrfvnpdtgrvlfecklhksgyitvahtgpydlvippngyfrfdswvnqfy
    tlapm
    

    Sequence, based on observed residues (ATOM records):
    >5iyqA (A:)
    kpftvpiltveemsnsrfpipleklytgpssafvvqpqngrcttdgvllgttqlsavnic
    nfrgdvtrvgishdytmnlvsqnwnnydpteeipaplgtpdfvgkiqglltqttradgst
    rahkatvstgsvhftpklgsvqfttdtnndfqtgqntkftpvgviqdghqnepqqwvlpn
    ysgtsghnvhlapavaptfpgeqllffrstmpgcsgypnmnldcllpqewvshfyqeaap
    aqsdvallrfvnpdtgrvlfecklhksgyitvahtgpydlvippngyfrfdswvnqfytl
    apm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >5iyqB (B:)
    kpftvpiltveemsnsrfpipleklytgpssafvvqpqngrcttdgvllgttqlsavnic
    nfrgdvtrvgishdytmnlvsqnwnnydpteeipaplgtpdfvgkiqglltqttradgst
    rahkatvstgsvhftpklgsvqfttdtnndfqtgqntkftpvgviqdgdhhqnepqqwvl
    pnysgtsghnvhlapavaptfpgeqllffrstmpgcsgypnmnldcllpqewvshfyqea
    apaqsdvallrfvnpdtgrvlfecklhksgyitvahtgpydlvippngyfrfdswvnqfy
    tlapm