PDB entry 5iy9

View 5iy9 on RCSB PDB site
Description: human holo-pic in the initial transcribing state (no iis)
Deposited on 2016-03-24, released 2016-05-18
The last revision was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: EM
Resolution: 6.3 Å
R-factor: N/A
AEROSPACI score: -0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: General transcription factor IIH subunit 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain '1':
    Compound: General transcription factor IIH subunit 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain '2':
    Compound: General transcription factor IIH subunit 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain '3':
    Compound: General transcription factor IIH subunit 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'A':
    Compound: DNA-directed RNA polymerase II subunit RPB1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: DNA-directed RNA polymerase II subunit RPB2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: DNA-directed RNA polymerase II subunit RPB3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: DNA-directed RNA polymerase II subunit RPB4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: DNA-directed RNA polymerase II subunit RPB5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: DNA-directed RNA polymerase II subunit RPB6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: DNA-directed RNA polymerase II subunit RPB7
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: DNA-directed RNA polymerase II subunit RPB8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: DNA-directed RNA polymerase II subunit RPB9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: DNA-directed RNA polymerase II subunit RPB10
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: DNA-directed RNA polymerase II subunit RPB11-a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: DNA-directed RNA polymerase II subunit RPB12
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: transcription initiation factor iib
    Species: Homo sapiens [TaxId:9606]
    Gene: GTF2B, TF2B, TFIIB
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: transcription initiation factor iia subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: GTF2A1, TF2A1
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: transcription initiation factor iia subunit 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GTF2A2, TF2A2
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: tata-box-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: TBP, GTF2D1, TF2D, TFIID
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: General transcription factor IIE subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: GTF2E1, TF2E1
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: transcription initiation factor iie subunit beta
    Species: Homo sapiens [TaxId:9606]
    Gene: GTF2E2, TF2E2
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: General transcription factor IIF subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: GTF2F1, RAP74
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: General transcription factor IIF subunit 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GTF2F2, RAP30
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: TFIIH basal transcription factor complex helicase XPB subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: TFIIH basal transcription factor complex helicase XPD subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: scp-X
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Chain 'Y':
    Compound: scp-Y
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Chain 'Z':
    Compound: RNA
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Heterogens: MG, ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain '0':
    Sequence, based on SEQRES records:
    >5iy90 (0:)
    mdeepertkrweggyertweilkedesgslkatiedilfkakrkrvfehhgqvrlgmmrh
    lyvvvdgsrtmedqdlkpnrltctlklleyfveeyfdqnpisqigiivtkskraekltel
    sgnprkhitslkkavdmtchgepslynslsiamqtlkhmpghtsrevliifsslttcdps
    niydliktlkaakirvsviglsaevrvctvlaretggtyhvildeshykellthhvsppp
    assssecslirmgfpqhtiaslsdqdakpsfsmahldgntepgltlggyfcpqcrakyce
    lpveckicgltlvsaphlarsyhhlfpldafqeipleeyngerfcygcqgelkdqhvyvc
    avcqnvfcvdcdvfvhdslhccpgcihkipapsgv
    

    Sequence, based on observed residues (ATOM records):
    >5iy90 (0:)
    rlgmmrhlyvvvdgsrtmedqdlkpnrltctlklleyfveeyfdqnpisqigiivtkskr
    aekltelsgnprkhitslkkavdmtchgepslynslsiamqtlkhmpghtsrevliifss
    lttcdpsniydliktlkaakirvsviglsaevrvctvlaretggtyhvildeshykellt
    hhvspppa
    

  • Chain '1':
    Sequence, based on SEQRES records:
    >5iy91 (1:)
    mvnvlkgvliecdpamkqfllyldesnalgkkfiiqdiddthvfviaelvnvlqervgel
    mdqnafsltqk
    

    Sequence, based on observed residues (ATOM records):
    >5iy91 (1:)
    mvnvlkgvliecdpamkqfllyldesnalgkkfiiqdiddthvfviaelvnvlqervgel
    md
    

  • Chain '2':
    Sequence, based on SEQRES records:
    >5iy92 (2:)
    mestpsrglnrvhlqcrnlqeflgglspgvldrlyghpatclavfrelpslaknwvmrml
    fleqplpqaavalwvkkefskaqeestgllsglriwhtqllpgglqglilnpifrqnlri
    allgggkawsddtsqlgpdkhardvpsldkyaeerwevvlhfmvgspsaavsqdlaqlls
    qaglmkstepgeppcitsagfqfllldtpaqlwyfmlqylqtaqsrgmdlveilsflfql
    sfstlgkdysvegmsdsllnflqhlrefglvfqrkrksrryyptrlainlssgvsgaggt
    vhqpgfivvetnyrlyayteselqialialfsemlyrfpnmvvaqvtresvqqaiasgit
    aqqiihflrtrahpvmlkqtpvlpptitdqirlwelerdrlrftegvlynqflsqvdfel
    llaharelgvlvfensakrlmvvtpaghsdvkrfwkrqkhss
    

    Sequence, based on observed residues (ATOM records):
    >5iy92 (2:)
    pgvldrlyghpatclavfrelpslaknwvmrmlflkkefskaqeestgllsglriwhtql
    lnlriallgggkawsddtsqlgpdkhvlhfmvgspsaavsqdlaqllsqaglmkstepge
    ppcitsagfqfllldtpaqlwyfmlqylqtaqsrgmdlveilsflfqlsfstlgkdysve
    gmsdsllnflqhlrefglvfqrtdqirlwelerdrlrftegvlynqflsqvdfelllaha
    relgvlvfensakrlmvvtpaghsdvkrfwkrqk
    

  • Chain '3':
    Sequence, based on SEQRES records:
    >5iy93 (3:)
    mvsdedelnllvivvdanpiwwgkqalkesqftlskcidavmvlgnshlfmnrsnklavi
    ashiqesrflypgkngrlgdffgdpgnppefnpsgskdgkyelltsaneviveeikdlmt
    ksdikgqhtetllagslakalcyihrmnkevkdnqemksrilvikaaedsalqymnfmnv
    ifaaqkqnilidacvldsdsgllqqacditgglylkvpqmpsllqyllwvflpdqdqrsq
    lilpppvhvdyraacfchrnlieigyvcsvclsifcnfspicttcetafkislppvlkak
    kkklkvsa
    

    Sequence, based on observed residues (ATOM records):
    >5iy93 (3:)
    edelnllvivvdanpiwwgkqtlskcidavmvlgnshlfmnrsnklaviashiqesrfly
    pkyelltsaneviveeikdlmtksdikgqhtetllagslakalcyihrmnkevkdnqemk
    srilvikaaedsalqymnfmnvifaaqkqnilidacvldsdsgllqqacditgglylkvp
    qmpsllqyllwvf
    

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5iy9A (A:)
    mhgggppsgdsacplrtikrvqfgvlspdelkrmsvteggikypetteggrpklgglmdp
    rqgviertgrcqtcagnmtecpghfghielakpvfhvgflvktmkvlrcvcffcskllvd
    snnpkikdilakskgqpkkrlthvydlckgkniceggeemdnkfgveqpegdedltkekg
    hggcgryqprirrsglelyaewkhvnedsqekkillspervheifkrisdeecfvlgmep
    ryarpewmivtvlpvpplsvrpavvmqgsarnqddlthkladivkinnqlrrneqngaaa
    hviaedvkllqfhvatmvdnelpglpramqksgrplkslkqrlkgkegrvrgnlmgkrvd
    fsartvitpdpnlsidqvgvprsiaanmtfaeivtpfnidrlqelvrrgnsqypgakyii
    rdngdridlrfhpkpsdlhlqtgykverhmcdgdivifnrqptlhkmsmmghrvrilpws
    tfrlnlsvttpynadfdgdemnlhlpqsletraeiqelamvprmivtpqsnrpvmgivqd
    tltavrkftkrdvflergevmnllmflstwdgkvpqpailkprplwtgkqifsliipghi
    ncirthsthpddedsgpykhispgdtkvvvengelimgilckkslgtsagslvhisylem
    ghditrlfysniqtvinnwllieghtigigdsiadsktyqdiqntikkakqdvievieka
    hnneleptpgntlrqtfenqvnrilndardktgssaqkslseynnfksmvvsgakgskin
    isqviavvgqqnvegkripfgfkhrtlphfikddygpesrgfvensylagltptefffha
    mggreglidtavktaetgyiqrrliksmesvmvkydatvrnsinqvvqlrygedglages
    vefqnlatlkpsnkafekkfrfdytneralrrtlqedlvkdvlsnahiqnelerefermr
    edrevlrvifptgdskvvlpcnllrmiwnaqkifhinprlpsdlhpikvvegvkelskkl
    vivngddplsrqaqenatllfnihlrstlcsrrmaeefrlsgeafdwllgeieskfnqai
    ahpgemvgalaaqslgepatqmtlntfhyagvsaknvtlgvprlkeliniskkpktpslt
    vfllgqsardaerakdilcrlehttlrkvtantaiyydpnpqstvvaedqewvnvyyemp
    dfdvarispwllrveldrkhmtdrkltmeqiaekinagfgddlncifnddnaeklvlrir
    imnsdenkmqeeeevvdkmdddvflrciesnmltdmtlqgieqiskvymhlpqtdnkkki
    iitedgefkalqewiletdgvslmrvlsekdvdpvrttsndiveiftvlgieavrkaler
    elyhvisfdgsyvnyrhlallcdtmtcrghlmaitrhgvnrqdtgplmkcsfeetvdvlm
    eaaahgesdpmkgvsenimlgqlapagtgcfdllldaekckygmeiptnipglgaagptg
    mffgsapspmggispamtpwnqgatpaygawspsvgsgmtpgaagfspsaasdasgfspg
    yspawsptpgspgspgpsspyipspggamspsysptspayeprspggytpqspsysptsp
    sysptspsysptspnysptspsysptspsysptspsysptspsysptspsysptspsysp
    tspsysptspsysptspsysptspsysptspsysptspsysptspsysptspsysptsps
    ysptspnysptspnytptspsysptspsysptspnytptspnysptspsysptspsyspt
    spsyspssprytpqsptytpsspsyspsspsyspaspkytptspsyspsspeytptspky
    sptspkysptspkysptsptyspttpkysptsptysptspvytptspkysptsptyspts
    pkysptsptysptspkgstysptspgysptsptysltspaispddsdeen
    

    Sequence, based on observed residues (ATOM records):
    >5iy9A (A:)
    dsacplrtikrvqfgvlspdelkrmsvteggikypetteggrpklgglmdprqgviertg
    rcqtcagnmtecpghfghielakpvfhvgflvktmkvlrcvcffcskllvdsnnpkikdi
    lakskgqpkkrlthvydlckgkniceggghggcgryqprirrsglelyaewkhvnedsqe
    kkillspervheifkrisdeecfvlgmepryarpewmivtvlpvpplsvrpavvmqgsar
    nqddlthkladivkinnqlrrneqngaaahviaedvkllqfhvatmvdnelpglpramqk
    sgrplkslkqrlkgkegrvrgnlmgkrvdfsartvitpdpnlsidqvgvprsiaanmtfa
    eivtpfnidrlqelvrrgnsqypgakyiirdngdridlrfhpkpsdlhlqtgykverhmc
    dgdivifnrqptlhkmsmmghrvrilpwstfrlnlsvttpynadfdgdemnlhlpqslet
    raeiqelamvprmivtpqsnrpvmgivqdtltavrkftkrdvflergevmnllmflstwd
    gkvpqpailkprplwtgkqifsliipghincirthsthpddedsgpykhispgdtkvvve
    ngelimgilckkslgtsagslvhisylemghditrlfysniqtvinnwllieghtigigd
    siadsktyqdiqntikkakqdvieviekahnneleptpgntlrqtfenqvnrilndardk
    tgssaqkslseynnfksmvvsgakgskinisqviavvgqqnvegkripfgfkhrtlphfi
    kddygpesrgfvensylagltptefffhamggreglidtavktaetgyiqrrliksmesv
    mvkydatvrnsinqvvqlrygedglagesvefqnlatlkpsnkafekkfrfdytneralr
    rtlqedlvkdvlsnahiqnelerefermredrevlrvifptgdskvvlpcnllrmiwnaq
    kifhinprlpsdlhpikvvegvkelskklvivngddplsrqaqenatllfnihlrstlcs
    rrmaeefrlsgeafdwllgeieskfnqaiahpgemvgalaaqslgepatqmtlntfhyag
    vsaknvtlgvprlkeliniskkpktpsltvfllgqsardaerakdilcrlehttlrkvta
    ntaiyydpnpqstvvaedqewvnvyyempdfdvarispwllrveldrkhmtdrkltmeqi
    aekinagfgddlncifnddnaeklvlririmnsdenkmqeeeevvdkmdddvflrciesn
    mltdmtlqgieqiskvymhlpqtdnkkkiiitedgefkalqewiletdgvslmrvlsekd
    vdpvrttsndiveiftvlgieavrkalerelyhvisfdgsyvnyrhlallcdtmtcrghl
    maitrhgvnrqdtgplmkcsfeetvdvlmeaaahgesdpmkgvsenimlgqlapagtgcf
    dllldaekckygme
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5iy9B (B:)
    mydadedmqydedddeitpdlwqeacwivissyfdekglvrqqldsfdefiqmsvqrive
    dappidlqaeaqhasgeveeppryllkfeqiylskpthwerdgapspmmpnearlrnlty
    saplyvditktvikegeeqlqtqhqktfigkipimlrstycllngltdrdlcelnecpld
    pggyfiingsekvliaqekmatntvyvfakkdskyaytgecrsclenssrptstiwvsml
    arggqgakksaigqrivatlpyikqevpiiivfralgfvsdrdilehiiydfedpemmem
    vkpsldeafviqeqnvalnfigsrgakpgvtkekrikyakevlqkemlphvgvsdfcetk
    kayflgymvhrlllaalgrrelddrdhygnkrldlagpllaflfrgmfknllkevriyaq
    kfidrgkdfnlelaiktriisdglkyslatgnwgdqkkahqaragvsqvlnrltfastls
    hlrrlnspigrdgklakprqlhntlwgmvcpaetpeghavglvknlalmayisvgsqpsp
    ilefleewsmenleeispaaiadatkifvngcwvgihkdpeqlmntlrklrrqmdiivse
    vsmirdirereiriytdagricrpllivekqklllkkrhidqlkereynnyswqdlvasg
    vveyidtleeetvmlamtpddlqekevaycstythceihpsmilgvcasiipfpdhnqsp
    rntyqsamgkqamgvyitnfhvrmdtlahvlyypqkplvttrsmeylrfrelpaginsiv
    aiasytgynqedsvimnrsavdrgffrsvfyrsykeqeskkgfdqeevfekptretcqgm
    rhaiydkldddgliapgvrvsgddviigktvtlpenedelestnrrytkrdcstflrtse
    tgivdqvmvtlnqegykfckirvrsvripqigdkfasrhgqkgtcgiqyrqedmpftceg
    itpdiiinphaipsrmtighlieclqgkvsankgeigdatpfndavnvqkisnllsdygy
    hlrgnevlyngftgrkitsqifigptyyqrlkhmvddkihsrargpiqilnrqpmegrsr
    dgglrfgemerdcqiahgaaqflrerlfeasdpyqvhvcnlcgimaiantrthtyecrgc
    rnktqislvrmpyackllfqelmsmsiaprmmsv
    

    Sequence, based on observed residues (ATOM records):
    >5iy9B (B:)
    ydedddeitpdlwqeacwivissyfdekglvrqqldsfdefiqmsvqrivedappidlqa
    eaqhasgeveeppryllkfeqiylskpthwerdgapspmmpnearlrnltysaplyvdit
    ktvikegeeqlqtqhqktfigkipimlrstycllngltdrdlcelnecpldpggyfiing
    sekvliaqekmatntvyvfakkdskyaytgecrsclenssrptstiwvsmlarggqgakk
    saigqrivatlpyikqevpiiivfralgfvsdrdilehiiydfedpemmemvkpsldeaf
    viqeqnvalnfigsrgakpgvtkekrikyakevlqkemlphvgvsdfcetkkayflgymv
    hrlllaalgrrelddrdhygnkrldlagpllaflfrgmfknllkevriyaqkfidrgkdf
    nlelaiktriisdglkyslatgnwgdqkkahqaragvsqvlnrltfastlshlrrlnspi
    grdgklakprqlhntlwgmvcpaetpeghavglvknlalmayisvgsqpspilefleews
    menleeispaaiadatkifvngcwvgihkdpeqlmntlrklrrqmdiivsevsmirdire
    reiriytdagricrpllivekqklllkkrhidqlkereynnyswqdlvasgvveyidtle
    eetvmlamtpddlqekevaycstythceihpsmilgvcasiipfpdhnqsprntyqsamg
    kqamgvyitnfhvrmdtlahvlyypqkplvttrsmeylrfrelpaginsivaiasytgyn
    qedsvimnrsavdrgffrsvfyrsykeqeskkgfdqeevfekptretcqgmrhaiydkld
    ddgliapgvrvsgddviigktvtlpenedelestnrrytkrdcstflrtsetgivdqvmv
    tlnqegykfckirvrsvripqigdkfasrhgqkgtcgiqyrqedmpftcegitpdiiinp
    haipsrmtighlieclqgkvsankgeigdatpfndavnvqkisnllsdygyhlrgnevly
    ngftgrkitsqifigptyyqrlkhmvddkihsrargpiqilnrqpmegrsrdgglrfgem
    erdcqiahgaaqflrerlfeasdpyqvhvcnlcgimaiantrthtyecrgcrnktqislv
    rmpyackllfqelmsmsiaprmmsv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >5iy9C (C:)
    mpyanqptvriteltdenvkfiientdlavansirrvfiaevpiiaidwvqidanssvlh
    defiahrlgliplisddivdklqysrdctceefcpecsveftldvrcnedqtrhvtsrdl
    isnsprvipvtsrnrdndpndyveqddilivklrkgqelrlrayakkgfgkehakwnpta
    gvafeydpdnalrhtvypkpeewpkseyseldedesqapydpngkperfyynvescgslr
    petivlsalsglkkklsdlqtqlsheiqsdvltin
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5iy9D (D:)
    maaggsdpragdveedasqlifpkefetaetllnsevhmllehrkqqnesaedeqelsev
    fmktlnytarfsrfknretiasvrslllqkklhkfelaclanlcpetaeeskalipsleg
    rfedeelqqilddiqtkrsfqy
    

    Sequence, based on observed residues (ATOM records):
    >5iy9D (D:)
    eedasqlifpkefetaetllnsevhmllehrkqqnesaedeqelsevfmktlnytarfsr
    fknretiasvrslllqkklhkfelaclanlcpetaeeskalipslegrfedeelqqildd
    iqtkrsfqy
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >5iy9E (E:)
    mddeeetyrlwkirktimqlchdrgylvtqdeldqtleefkaqsgdkpsegrprrtdltv
    lvahnddptdqmfvffpeepkvgiktikvycqrmqeenitralivvqqgmtpsakqslvd
    mapkyileqflqqellinitehelvpehvvmtkeevtellaryklrenqlpriqagdpva
    ryfgikrgqvvkiirpsetagryityrlvq
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5iy9F (F:)
    msdnednfdgddfddveedeglddlenaeeegqenveilpsgerpqanqkrittpymtky
    erarvlgtralqiamcapvmvelegetdplliamkelkarkipiiirrylpdgsyedwgv
    deliitd
    

    Sequence, based on observed residues (ATOM records):
    >5iy9F (F:)
    gerpqanqkrittpymtkyerarvlgtralqiamcapvmvelegetdplliamkelkark
    ipiiirrylpdgsyedwgvdeliitd
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5iy9G (G:)
    mfyhisleheillhpryfgpnllntvkqklftevegtctgkygfviavttidnigagviq
    pgrgfvlypvkykaivfrpfkgevvdavvtqvnkvglfteigpmscfisrhsipsemefd
    pnsnppcyktmdediviqqddeirlkivgtrvdkndifaigslmddylglvs
    

    Sequence, based on observed residues (ATOM records):
    >5iy9G (G:)
    mfyhisleheillhpryfgpnllntvkqklftevegtctgkygfviavttidnigagviq
    pgrgfvlypvkykaivfrpfkgevvdavvtqvnkvglfteigpmscfisrhsipsemefd
    pnsnppcyktmdediviqqddeirlkivgtrvdkndifaigslmddylglv
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records:
    >5iy9H (H:)
    magilfedifdvkdidpegkkfdrvsrlhcesesfkmdlildvniqiypvdlgdkfrlvi
    astlyedgtlddgeynptddrpsradqfeyvmygkvyriegdetsteaatrlsayvsygg
    llmrlqgdannlhgfevdsrvyllmkklaf
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records:
    >5iy9I (I:)
    mepdgtyepgfvgirfcqecnnmlypkedkenrillyacrncdyqqeadnsciyvnkith
    evdeltqiiadvsqdptlprtedhpcqkcghkeavffqshsaraedamrlyyvctaphcg
    hrwte
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records:
    >5iy9J (J:)
    miipvrcftcgkivgnkweaylgllqaeytegdaldalglkryccrrmllahvdliekll
    nyaplek
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records:
    >5iy9K (K:)
    mnappafesfllfegekkitinkdtkvpnaclftinkedhtlgniiksqllkdpqvlfag
    ykvphplehkiiirvqttpdyspqeaftnaitdliselslleerfrvaikdkqegie
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >5iy9L (L:)
    mdtqkdvqppkqqpmiyicgechteneiksrdpircrecgyrimykkrtkrlvvfdar
    

    Sequence, based on observed residues (ATOM records):
    >5iy9L (L:)
    qpmiyicgechteneiksrdpircrecgyrimykkrtkrlvvfdar
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >5iy9M (M:)
    mastsrldalprvtcpnhpdailvedyragdmicpecglvvgdrvidvgsewrtfsndka
    tkdpsrvgdsqnpllsdgdlstmigkgtgaasfdefgnskyqnrrtmsssdrammnafke
    ittmadrinlprnivdrtnnlfkqvyeqkslkgrandaiasaclyiacrqegvprtfkei
    cavsriskkeigrcfklilkaletsvdlittgdfmsrfcsnlclpkqvqmaathiarkav
    eldlvpgrspisvaaaaiymasqasaekrtqkeigdiagvadvtirqsyrliyprapdlf
    ptdfkfdtpvdklpql
    

    Sequence, based on observed residues (ATOM records):
    >5iy9M (M:)
    ldalprvtcpnhpdailvedyragdmicpecglvvgdrvidvgsewrtfsndkatkdpsr
    vgdsqnpllsdgdlstmigkgtgaasfdefgnskyqnrrtmsssdrammnafkeittmad
    rinlprnivdrtnnlfkqvyeqkslkgrandaiasaclyiacrqegvprtfkeicavsri
    skkeigrcfklilkaletsvdlittgdfmsrfcsnlclpkqvqmaathiarkaveldlvp
    grspisvaaaaiymasqasaekrtqkeigdiagvadvtirqsyrliyprapdlfptdfkf
    dtpvdklpql
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >5iy9N (N:)
    mansantntvpklyrsviedvindvrdiflddgvdeqvlmelktlwenklmqsravdgfh
    seeqqlllqvqqqhqpqqqqhhhhhhhqqaqpqqtvpqqaqtqqvlipasqqatapqviv
    pdskliqhmnasnmsaaataatlalpagvtpvqqiltnsgqllqvvraangaqyifqpqq
    svvlqqqvipqmqpggvqapviqqvlaplpggispqtgviiqpqqilftgnktqvipttv
    aaptpaqaqitatgqqqpqaqpaqtqaplvlqvdgtgdtsseededeeedydddeeedke
    kdgaedgqveeeplnseddvsdeegqelfdtenvvvcqydkihrsknkwkfhlkdgimnl
    ngrdyifskaigdaew
    

    Sequence, based on observed residues (ATOM records):
    >5iy9N (N:)
    tvpklyrsviedvindvrdiflddgvdeqvlmelktlwenklmgqveeeplnseddvsde
    egqelfdtenvvvcqydkihrsknkwkfhlkdgimnlngrdyifskaigdaew
    

  • Chain 'O':
    Sequence, based on SEQRES records:
    >5iy9O (O:)
    mayqlyrnttlgnslqesldeliqsqqitpqlalqvllqfdkainaalaqrvrnrvnfrg
    slntyrfcdnvwtfvlndvefrevtelikvdkvkivacdgkntgsntte
    

    Sequence, based on observed residues (ATOM records):
    >5iy9O (O:)
    mayqlyrnttlgnslqesldeliqsqqitpqlalqvllqfdkainaalaqrvrnrvnfrg
    slntyrfcdnvwtfvlndvefrevtelikvdkvkivacd
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >5iy9P (P:)
    mdqnnslppyaqglaspqgamtpgipifspmmpygtgltpqpiqntnslsileeqqrqqq
    qqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqavaaaavqqstsqqatqgtsgqapq
    lfhsqtlttaplpgttplypspmtpmtpitpatpasessgivpqlqnivstvnlgckldl
    ktialrarnaeynpkrfaavimrireprttalifssgkmvctgakseeqsrlaarkyarv
    vqklgfpakfldfkiqnmvgscdvkfpirleglvlthqqfssyepelfpgliyrmikpri
    vllifvsgkvvltgakvraeiyeafeniypilkgfrktt
    

    Sequence, based on observed residues (ATOM records):
    >5iy9P (P:)
    tpasessgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttal
    ifssgkmvctgakseeqsrlaarkyarvvqklgfpakfldfkiqnmvgscdvkfpirleg
    lvlthqqfssyepelfpgliyrmikprivllifvsgkvvltgakvraeiyeafeniypil
    kgfrk
    

  • Chain 'Q':
    Sequence, based on SEQRES records:
    >5iy9Q (Q:)
    madpdvltevpaalkrlakyvirgfygiehalaldilirnscvkeedmlellkfdrkqlr
    svlnnlkgdkfikcrmrvetaadgkttrhnyyfinyrtlvnvvkykldhmrrrietderd
    stnrasfkcpvcsstftdleanqlfdpmtgtfrctfchteveedesampkkdartllarf
    neqiepiyallretedvnlayeilepepteipalkqskdhaattagaaslagghhreawa
    tkgpsyedlytqnvvinmddqedlhraslegksakerpiwlrestvqgaygsedmkeggi
    dmdafqereeghagpddneevmrallihekktssamagsvgaaapvtaangsdsesetse
    sdddspprpaavavhkreedeeeddefeevaddpivmvagrpfsysevsqrpelvaqmtp
    eekeayiamgqrmfedlfe
    

    Sequence, based on observed residues (ATOM records):
    >5iy9Q (Q:)
    paalkrlakyvirgfygiehalaldilirnscvkeedmlellkfdrkqlrsvlnnlkgdk
    fikcrmryfinyrtlvnvvkykldhmrrrietderdstnrasfkcpvcsstftdleanql
    fdpmtgtfrctfchteveedesampkkdartllarfneqiepiyallretedvnlayeil
    

  • Chain 'R':
    Sequence, based on SEQRES records:
    >5iy9R (R:)
    mdpsllrerelfkkralstpvvekrsassesssssskkkktkvehggssgskqnsdhsng
    sfnlkalsgssgykfgvlakivnymktrhqrgdthpltldeildetqhldiglkqkqwlm
    tealvnnpkievidgkyafkpkynvrdkkallrlldqhdqrglggilledieealpnsqk
    avkalgdqilfvnrpdkkkilffndkscqfsvdeefqklwrsvtvdsmdeekieeylkrq
    gissmqesgpkkvapiqrrkkpasqkkrrfkthnehlagvlkdysditssk
    

    Sequence, based on observed residues (ATOM records):
    >5iy9R (R:)
    fgvlakivnymktrhqrgdthpltldeildetqhldiglkqkqwlmtealvnnpkievid
    gkyafkpkynvrdkkallrlldqhdqrglggilledieealpnsqkavkalgdqilfvnr
    pdkkkilffndkscqfsvdeefqklwrsvtvdsmdeekieeylkr
    

  • Chain 'S':
    Sequence, based on SEQRES records:
    >5iy9S (S:)
    maalgpssqnvteyvvrvpknttkkynimafnaadkvnfatwnqarlerdlsnkkiyqee
    empesgagsefnrklreearrkkygivlkefrpedqpwllrvngksgrkfkgikkggvte
    ntsyyiftqcpdgafeafpvhnwynftplarhrtltaeeaeeewerrnkvlnhfsimqqr
    rlkdqdqdedeeekekrgrrkaselrihdleddlemssdasdasgeeggrvpkakkkapl
    akggrkkkkkkgsddeafedsddgdfegqevdymsdgssssqeepeskakapqqeegpkg
    vdeqsdsseeseeekppeedkeeeeekkaptpqekkrrkdsseesdsseesdidseassa
    lfmakkktppkrerkpsggssrgnsrpgtpsaeggstsstlraaaskleqgkrvsempaa
    krlrldtgpqslsgkstpqppsgkttpnsgdvqvtedavrryltrkpmttkdllkkfqtk
    ktglsseqtvnvlaqilkrlnperkmindkmhfslke
    

    Sequence, based on observed residues (ATOM records):
    >5iy9S (S:)
    gpssqnvteyvvrvpknttkkynimafnaadkvnfatwnqarlerdlsnkpedqpwllrv
    ngksgrkfkgikkggvtentsyyiftqcpdgafeafpvhnwynftplarhrtltaeeaee
    ewerrnkvlnhfsimqqr
    

  • Chain 'T':
    Sequence, based on SEQRES records:
    >5iy9T (T:)
    maergeldltgakqntgvwlvkvpkylsqqwakasgrgevgklriaktqgrtevsftlne
    dlanihdiggkpasvsaprehpfvlqsvggqtltvftesssdklslegivvqraecrpaa
    senymrlkrlqieesskpvrlsqqldkvvttnykpvanhqynieyerkkkedgkraradk
    qhvldmlfsafekhqyynlkdlvditkqpvvylkeilkeigvqnvkgihkntwelkpeyr
    hyqgeeksd
    

    Sequence, based on observed residues (ATOM records):
    >5iy9T (T:)
    aergeldltgakqntgvwlvkvpkylsqqwakasgrgevgklriaktqgrtevsftlned
    lanehpfvlqsvggqtltvftesssdklslegivvqraecrpaasenymrlkrlqieess
    kpvrlsqqldkvvttnykpvanhqynieyerkkkedgkraradkqhvldmlfsafekhqy
    ynlkdlvditkqpvvylkeilkeigvqnvkgihkntwelkpe
    

  • Chain 'V':
    Sequence, based on SEQRES records:
    >5iy9V (V:)
    mgkrdradrdkkksrkrhyedeeddeedapgndpqeavpsaagkqvdesgtkvdeygakd
    yrlqmplkddhtsrplwvapdghifleafspvykyaqdflvaiaepvcrpthvheyklta
    yslyaavsvglqtsditeylrklsktgvpdgimqfiklctvsygkvklvlkhnryfvesc
    hpdviqhllqdpvirecrlrnsegeatelitetftsksaisktaessggpstsrvtdpqg
    ksdipmdlfdfyeqmdkdeeeeeetqtvsfevkqemieelqkrcihleypllaeydfrnd
    svnpdinidlkptavlrpyqekslrkmfgngrarsgvivlpcgagkslvgvtaactvrkr
    clvlgnsavsveqwkaqfkmwstiddsqicrftsdakdkpigcsvaistysmlghttkrs
    weaervmewlktqewglmildevhtipakmfrrvltivqahcklgltatlvreddkivdl
    nfligpklyeanwmelqnngyiakvqcaevwcpmspefyreyvaiktkkrillytmnpnk
    fracqflikfherrndkiivfadnvfalkeyairlnkpyiygptsqgermqilqnfkhnp
    kintifiskvgdtsfdlpeanvliqisshggsrrqeaqrlgrvlrakkgmvaeeynaffy
    slvsqdtqemaystkrqrflvdqgysfkvitklagmeeedlafstkeeqqqllqkvlaat
    dldaeeevvagefgsrssqasrrfgtmssmsgaddtvymeyhssrskapskhvhplfkrf
    rk
    

    Sequence, based on observed residues (ATOM records):
    >5iy9V (V:)
    ipmdlfdfyeqmdkdeeeeeetqtvsfevkqemieelqkrcihleypllaeydfrndsvn
    pdinidlkptavlrpyqekslrkmfgngrarsgvivlpcgagkslvgvtaactvrkrclv
    lgnsavsveqwkaqfkmwstiddsqicrftsdakdkpigcsvaistysmlghttkrswea
    ervmewlktqewglmildevhtipakmfrrvltivqahcklgltatlvreddkivdlnfl
    igpklyeanwmelqnngyiakvqcaevwcpmspefyreyvaiktkkrillytmnpnkfra
    cqflikfherrndkiivfadnvfalkeyairlnkpyiygptsqgermqilqnfkhnpkin
    tifiskvgdtsfdlpeanvliqisshggsrrqeaqrlgrvlrakkgmvaeeynaffyslv
    sqdtqemaystkrqrflvdqgysfkvitklagmeeedlafstkeeqqqllqkvla
    

  • Chain 'W':
    Sequence, based on SEQRES records:
    >5iy9W (W:)
    mklnvdgllvyfpydyiypeqfsymrelkrtldakghgvlempsgtgktvsllalimayq
    rayplevtkliycsrtvpeiekvieelrkllnfyekqegeklpflglalssrknlcihpe
    vtplrfgkdvdgkchsltasyvraqyqhdtslphcrfyeefdahgrevplpagiynlddl
    kalgrrqgwcpyflarysilhanvvvysyhylldpkiadlvskelarkavvvfdeahnid
    nvcidsmsvnltrrtldrcqgnletlqktvlriketdeqrlrdeyrrlveglreasaare
    tdahlanpvlpdevlqeavpgsirtaehflgflrrlleyvkwrlrvqhvvqesppaflsg
    laqrvciqrkplrfcaerlrsllhtleitdladfspltllanfatlvstyakgftiiiep
    fddrtptianpilhfscmdaslaikpvferfqsviitsgtlspldiypkildfhpvtmat
    ftmtlarvclcpmiigrgndqvaisskfetrediavirnygnlllemsavvpdgivafft
    syqymestvaswyeqgileniqrnkllfietqdgaetsvalekyqeacengrgaillsva
    rgkvsegidfvhhygravimfgvpyvytqsrilkarleylrdqfqirendfltfdamrha
    aqcvgrairgktdyglmvfadkrfargdkrgklprwiqehltdanlnltvdegvqvakyf
    lrqmaqpfhredqlglsllsleqleseetlkrieqiaqql
    

    Sequence, based on observed residues (ATOM records):
    >5iy9W (W:)
    dyiypeqfsymrelkrtldakghgvlempsgtgktvsllalimayqrayplevtkliycs
    rtvpeiekvieelrkllnfyekqegeklpflglalssrknlcihpevtplrfgkdvdgkc
    hsltasyvraqyqhdtslphcrfyeefdahgrevplpagiynlddlkalgrrqgwcpyfl
    arysilhanvvvysyhylldpkiadlvskelarkavvvfdeahnidnvcidsmsvnltrr
    tldrcqgnletlqktvlriketdeqrlrdeyrrlveglreasaaretdahlanpvlpdev
    lqeavpgsirtaehflgflrrlleyvkwrlrvfspltllanfatlvstyakgftiiiepf
    ddrtptianpilhfscmdaslaikpvferfqsviitsgtlspldiypkildfhpvtmatf
    tmtlarvclcpmiigrgndqvaisskfetrediavirnygnlllemsavvpdgivaffts
    yqymestvaswyeqgileniqrnkllfietqdgaetsvalekyqeacengrgaillsvar
    gkvsegidfvhhygravimfgvpyvytqsrilkarleylrdqfqirendfltfdamrhaa
    qcvgrairgktdyglmvfadkrfargdkrgklprwiqehltdanlnltvdegvqvakyfl
    rqmaq
    

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    No sequence available.