PDB entry 5ixz

View 5ixz on RCSB PDB site
Description: crystal structure of the signaling protein complex 5
Deposited on 2016-03-23, released 2017-11-01
The last revision was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alr2278 protein
    Species: Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) [TaxId:103690]
    Gene: alr2278
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8YUQ7 (0-181)
      • engineered mutation (138)
  • Chain 'B':
    Compound: Alr2278 protein
    Species: Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) [TaxId:103690]
    Gene: alr2278
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8YUQ7 (0-181)
      • engineered mutation (138)
  • Heterogens: HEM, DMS, MLI, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5ixzA (A:)
    myglvnkaiqdmiskhhgedtweaikqkagledidffvgmeaysddvtyhlvgaasevlg
    kpaeelliafgeywvtytseegygellasagdslpefmenldnlharvglsfpqlrppaf
    ecqhtssksmelhyqstraglapmvlgllhglgkrfqtkvevtqtafretgedhdifsik
    ye
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >5ixzB (B:)
    myglvnkaiqdmiskhhgedtweaikqkagledidffvgmeaysddvtyhlvgaasevlg
    kpaeelliafgeywvtytseegygellasagdslpefmenldnlharvglsfpqlrppaf
    ecqhtssksmelhyqstraglapmvlgllhglgkrfqtkvevtqtafretgedhdifsik
    ye