PDB entry 5ixu

View 5ixu on RCSB PDB site
Description: crystal structure of an uncharacterized nipsnap domain protein from burkholderia xenovorans
Deposited on 2016-03-23, released 2016-03-30
The last revision was dated 2016-03-30, with a file datestamp of 2016-03-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Burkholderia xenovorans (strain LB400) [TaxId:266265]
    Gene: Bxe_B0070
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ixuA (A:)
    mahhhhhhmrgednmlvemrtyritagkvpeflkiyqdeglgiitqyarlrgcwtqdsgt
    lnsvvfwwayddyshraaqrerlaadpqwqaftprivpylehqesvflvpaafcpdv
    

    Sequence, based on observed residues (ATOM records):
    >5ixuA (A:)
    mlvemrtyritagkvpeflkiyqdeglgiitqyarlrgcwtqdsgtlnsvvfwwayddys
    hraaqrerlaadpqwqaftprivpylehqesvflvpaafcpd