PDB entry 5ixo

View 5ixo on RCSB PDB site
Description: crystal structure of the arabidopsis receptor kinase haesa lrr ectdomain (apo form).
Deposited on 2016-03-23, released 2016-04-20
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Receptor-like protein kinase 5
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: RLK5, HAE, At4g28490, F21O9.180
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, MG, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ixoA (A:)
    gssmgslnqdatilrqaklglsdpaqslsswsdnndvtpckwlgvscdatsnvvsvdlss
    fmlvgpfpsilchlpslhslslynnsingslsaddfdtchnlisldlsenllvgsipksl
    pfnlpnlkfleisgnnlsdtipssfgefrkleslnlagnflsgtipaslgnvttlkelkl
    aynlfspsqipsqlgnltelqvlwlagcnlvgpippslsrltslvnldltfnqltgsips
    witqlktveqielfnnsfsgelpesmgnmttlkrfdasmnkltgkipdnlnllnleslnl
    fenmlegplpesitrsktlselklfnnrltgvlpsqlgansplqyvdlsynrfsgeipan
    vcgegkleylilidnsfsgeisnnlgkcksltrvrlsnnklsgqiphgfwglprlsllel
    sdnsftgsipktiigaknlsnlrisknrfsgsipneigslngiieisgaendfsgeipes
    lvklkqlsrldlsknqlsgeiprelrgwknlnelnlannhlsgeipkevgilpvlnyldl
    ssnqfsgeiplelqnlklnvlnlsynhlsgkipplyankiyahdfignpglcvdldglcr
    kitrsklegsenlyfq
    

    Sequence, based on observed residues (ATOM records):
    >5ixoA (A:)
    slnqdatilrqaklglsdpaqslsswsdnndvtpckwlgvscdatsnvvsvdlssfmlvg
    pfpsilchlpslhslslynnsingslsaddfdtchnlisldlsenllvgsipkslpfnlp
    nlkfleisgnnlsdtipssfgefrkleslnlagnflsgtipaslgnvttlkelklaynlf
    spsqipsqlgnltelqvlwlagcnlvgpippslsrltslvnldltfnqltgsipswitql
    ktveqielfnnsfsgelpesmgnmttlkrfdasmnkltgkipdnlnllnleslnlfenml
    egplpesitrsktlselklfnnrltgvlpsqlgansplqyvdlsynrfsgeipanvcgeg
    kleylilidnsfsgeisnnlgkcksltrvrlsnnklsgqiphgfwglprlsllelsdnsf
    tgsipktiigaknlsnlrisknrfsgsipneigslngiieisgaendfsgeipeslvklk
    qlsrldlsknqlsgeiprelrgwknlnelnlannhlsgeipkevgilpvlnyldlssnqf
    sgeiplelqnlklnvlnlsynhlsgkipplyankiyahdfignpglcvdldglcrk