PDB entry 5ixm

View 5ixm on RCSB PDB site
Description: the lps transporter lptde from yersinia pestis, core complex
Deposited on 2016-03-23, released 2016-05-18
The last revision was dated 2016-06-15, with a file datestamp of 2016-06-10.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: LPS-assembly protein LptD
    Species: Yersinia pestis [TaxId:632]
    Gene: lptD, imp, ostA, YPO0495, y3680, YP_3684
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZIK3 (21-576)
      • expression tag (19-20)
  • Chain 'B':
    Compound: LPS-assembly lipoprotein LptE
    Species: Yersinia pestis [TaxId:632]
    Gene: lptE, rlpB, YPO2609, y1183, YP_1104
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: LPS-assembly protein LptD
    Species: Yersinia pestis [TaxId:632]
    Gene: lptD, imp, ostA, YPO0495, y3680, YP_3684
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZIK3 (21-576)
      • expression tag (19-20)
  • Chain 'D':
    Compound: LPS-assembly lipoprotein LptE
    Species: Yersinia pestis [TaxId:632]
    Gene: lptE, rlpB, YPO2609, y1183, YP_1104
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: LPS-assembly protein LptD
    Species: Yersinia pestis [TaxId:632]
    Gene: lptD, imp, ostA, YPO0495, y3680, YP_3684
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZIK3 (21-576)
      • expression tag (20)
  • Chain 'F':
    Compound: LPS-assembly lipoprotein LptE
    Species: Yersinia pestis [TaxId:632]
    Gene: lptE, rlpB, YPO2609, y1183, YP_1104
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: LPS-assembly protein LptD
    Species: Yersinia pestis [TaxId:632]
    Gene: lptD, imp, ostA, YPO0495, y3680, YP_3684
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: LPS-assembly lipoprotein LptE
    Species: Yersinia pestis [TaxId:632]
    Gene: lptE, rlpB, YPO2609, y1183, YP_1104
    Database cross-references and differences (RAF-indexed):
  • Heterogens: C8E, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ixmA (A:)
    msnhhhhhhhhhhenlyfqsmsgflipnakftsnngfefllpyywniapnfdatitphym
    errglqwqnefryllapgsgtmaldwlpndriytgpdgtdknatrwlyywghsgvmdqvw
    rfninytrvsdpayftdltsqygsttdgyatqiftagyanenwnatlsskqfqvftaagn
    snayraqpqldmnyykndvgpfdmhvygqaakftsvnptnpeasrfhieptvnlplsnsw
    gsinteakllathyqqdipasfadnasnpklkdsvnrvlpqfkvdgkvvfdrsmdwatgf
    tqtlepraqylyvpyrnqddiyiydttlmqsdysglfrdrtysgldriasanqvstglts
    riyddarverfnvsvgqiyyfsrsrtgnteaidnsnatgslvwagdtfwrindqlglkgg
    aqydtrlgsltlgnaimeyrkdadrmiqlnyryaspkyiqaavpkvynpdyqqgisqvgt
    taswpiadrwaivgayyydtkakqpasqlvglqyntccwavnlgyerkitgwnaqgqtsk
    ydnkigfnielrglsgghslgtaqmlnsgilpyqsaf
    

    Sequence, based on observed residues (ATOM records):
    >5ixmA (A:)
    smsgflipnakftsnngfefllpyywniapnfdatitphymerrglqwqnefryllapgs
    gtmaldwlpndriytgpdgtdknatrwlyywghsgvmdqvwrfninytrvsdpayftdlt
    sqygsttdgyatqiftagyanenwnatlsskqfqvftaagnsnayraqpqldmnyykndv
    gpfdmhvygqaakftsvnptnpeasrfhieptvnlplsnswgsinteakllathyqqdip
    asfadnasnpklkdsvnrvlpqfkvdgkvvfdrsmdwatgftqtlepraqylyvpyrnqd
    diyiydttlmqsdysglfrdrtysgldriasanqvstgltsriyddarverfnvsvgqiy
    yfsrsrtgntenatgslvwagdtfwrindqlglkggaqydtrlgsltlgnaimeyrkdad
    rmiqlnyryaspkyiqaavpkvynpdyqqgisqvgttaswpiadrwaivgayyydtkakq
    pasqlvglqyntccwavnlgyerkitgwnaqgqtskydnkigfniegtaqmlnsgilpyq
    saf
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5ixmB (B:)
    apntsgfnlrgttqvptelqklllessdpygplarsirqqlrlnnvtivddamrkdiptl
    riigssesqetvsifrngvaaenqlvlhvqaqvlipghdiyplqvnvfrtffdnpltala
    keaeaevlrqemreqaaqqlvrqlltvhaaevkntqkngdkpvsdanaaqgstptavnet
    tlgepavstsakhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5ixmB (B:)
    fnlrgttqtelqklllessdpygplarsirqqlrlnnvtivddamrkdiptlriigsses
    qetvsifrngvaaenqlvlhvqaqvlipghdiyplqvnvfrtffdnpltalakeaeaevl
    rqemreqaaqqlvrqlltvha
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5ixmC (C:)
    msnhhhhhhhhhhenlyfqsmsgflipnakftsnngfefllpyywniapnfdatitphym
    errglqwqnefryllapgsgtmaldwlpndriytgpdgtdknatrwlyywghsgvmdqvw
    rfninytrvsdpayftdltsqygsttdgyatqiftagyanenwnatlsskqfqvftaagn
    snayraqpqldmnyykndvgpfdmhvygqaakftsvnptnpeasrfhieptvnlplsnsw
    gsinteakllathyqqdipasfadnasnpklkdsvnrvlpqfkvdgkvvfdrsmdwatgf
    tqtlepraqylyvpyrnqddiyiydttlmqsdysglfrdrtysgldriasanqvstglts
    riyddarverfnvsvgqiyyfsrsrtgnteaidnsnatgslvwagdtfwrindqlglkgg
    aqydtrlgsltlgnaimeyrkdadrmiqlnyryaspkyiqaavpkvynpdyqqgisqvgt
    taswpiadrwaivgayyydtkakqpasqlvglqyntccwavnlgyerkitgwnaqgqtsk
    ydnkigfnielrglsgghslgtaqmlnsgilpyqsaf
    

    Sequence, based on observed residues (ATOM records):
    >5ixmC (C:)
    smsgflipnakftsnngfefllpyywniapnfdatitphymerrglqwqnefryllapgs
    gtmaldwlpndriytgpdgtdknatrwlyywghsgvmdqvwrfninytrvsdpayftdlt
    sqygsttdgyatqiftagyanenwnatlsskqfqvftaagnsnayraqpqldmnyykndv
    gpfdmhvygqaakftsvnptnpeasrfhieptvnlplsnswgsinteakllathyqqdip
    asfadnasnpklkdsvnrvlpqfkvdgkvvfdrsmdwatgftqtlepraqylyvpyrnqd
    diyiydttlmqsdysglfrdrtysgldriasanqvstgltsriyddarverfnvsvgqiy
    yfsrsrtgntenatgslvwagdtfwrindqlglkggaqydtrlgsltlgnaimeyrkdad
    rmiqlnyryaspkyiqaavpkvynpdyqqgisqvgttaswpiadrwaivgayyydtkakq
    pasqlvglqyntccwavnlgyerkitgwnaqgqtskydnkigfnitaqmlnsgilpyqsa
    f
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5ixmD (D:)
    apntsgfnlrgttqvptelqklllessdpygplarsirqqlrlnnvtivddamrkdiptl
    riigssesqetvsifrngvaaenqlvlhvqaqvlipghdiyplqvnvfrtffdnpltala
    keaeaevlrqemreqaaqqlvrqlltvhaaevkntqkngdkpvsdanaaqgstptavnet
    tlgepavstsakhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5ixmD (D:)
    fnlrgttqvptelqklllessdpygplarsirqqlrlnnvtivddamrkdiptlriigss
    esqetvsifrngvaaenqlvlhvqaqvlipghdiyplqvnvfrtffdnpltalakeaeae
    vlrqemreqaaqqlvrqlltvhaaev
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5ixmE (E:)
    msnhhhhhhhhhhenlyfqsmsgflipnakftsnngfefllpyywniapnfdatitphym
    errglqwqnefryllapgsgtmaldwlpndriytgpdgtdknatrwlyywghsgvmdqvw
    rfninytrvsdpayftdltsqygsttdgyatqiftagyanenwnatlsskqfqvftaagn
    snayraqpqldmnyykndvgpfdmhvygqaakftsvnptnpeasrfhieptvnlplsnsw
    gsinteakllathyqqdipasfadnasnpklkdsvnrvlpqfkvdgkvvfdrsmdwatgf
    tqtlepraqylyvpyrnqddiyiydttlmqsdysglfrdrtysgldriasanqvstglts
    riyddarverfnvsvgqiyyfsrsrtgnteaidnsnatgslvwagdtfwrindqlglkgg
    aqydtrlgsltlgnaimeyrkdadrmiqlnyryaspkyiqaavpkvynpdyqqgisqvgt
    taswpiadrwaivgayyydtkakqpasqlvglqyntccwavnlgyerkitgwnaqgqtsk
    ydnkigfnielrglsgghslgtaqmlnsgilpyqsaf
    

    Sequence, based on observed residues (ATOM records):
    >5ixmE (E:)
    msgflipnakftsnngfefllpyywniapnfdatitphymerrglqwqnefryllapgsg
    tmaldwlpndriytgpdgtdknatrwlyywghsgvmdqvwrfninytrvsdpayftdlts
    qygsttdgyatqiftagyanenwnatlsskqfqvftaagnsnayraqpqldmnyykndvg
    pfdmhvygqaakftsvnptnpeasrfhieptvnlplsnswgsinteakllathyqqdipa
    sfadnasnpklkdsvnrvlpqfkvdgkvvfdrsmdwatgftqtlepraqylyvpyrnqdd
    iyiydttlmqsdysglfrdrtysgldriasanqvstgltsriyddarverfnvsvgqiyy
    fsrsrtgntensnatgslvwagdtfwrindqlglkggaqydtrlgsltlgnaimeyrkda
    drmiqlnyryaspkyiqaavpkvyqqgisqvgttaswpiadrwaivgayyydtkakqpas
    qlvglqyntccwavnlgyerkitgwnaqgqtskydnkigfnitaqmlnsgilpyqsaf
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5ixmF (F:)
    apntsgfnlrgttqvptelqklllessdpygplarsirqqlrlnnvtivddamrkdiptl
    riigssesqetvsifrngvaaenqlvlhvqaqvlipghdiyplqvnvfrtffdnpltala
    keaeaevlrqemreqaaqqlvrqlltvhaaevkntqkngdkpvsdanaaqgstptavnet
    tlgepavstsakhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5ixmF (F:)
    nlrgttqvptelqklllessdpygplarsirqqlrlnnvtivddamrkdiptlriigsse
    sqetvsifrngvaaenqlvlhvqaqvlipghdiyplqvnvfrtffdnpltalakeaeaev
    lrqemreqaaqqlvrqlltvhaaev
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5ixmG (G:)
    msnhhhhhhhhhhenlyfqsmsgflipnakftsnngfefllpyywniapnfdatitphym
    errglqwqnefryllapgsgtmaldwlpndriytgpdgtdknatrwlyywghsgvmdqvw
    rfninytrvsdpayftdltsqygsttdgyatqiftagyanenwnatlsskqfqvftaagn
    snayraqpqldmnyykndvgpfdmhvygqaakftsvnptnpeasrfhieptvnlplsnsw
    gsinteakllathyqqdipasfadnasnpklkdsvnrvlpqfkvdgkvvfdrsmdwatgf
    tqtlepraqylyvpyrnqddiyiydttlmqsdysglfrdrtysgldriasanqvstglts
    riyddarverfnvsvgqiyyfsrsrtgnteaidnsnatgslvwagdtfwrindqlglkgg
    aqydtrlgsltlgnaimeyrkdadrmiqlnyryaspkyiqaavpkvynpdyqqgisqvgt
    taswpiadrwaivgayyydtkakqpasqlvglqyntccwavnlgyerkitgwnaqgqtsk
    ydnkigfnielrglsgghslgtaqmlnsgilpyqsaf
    

    Sequence, based on observed residues (ATOM records):
    >5ixmG (G:)
    sgflipnakftsnngfefllpyywniapnfdatitphymerrglqwqnefryllapgsgt
    maldwlpndriytgpdgtdknatrwlyywghsgvmdqvwrfninytrvsdpayftdltsq
    ygsttdgyatqiftagyanenwnatlsskqfqvftaagnsnayraqpqldmnyykndvgp
    fdmhvygqaakftsvnptnpeasrfhieptvnlplsnswgsinteakllathyqqdipas
    fadnasnpklkdsvnrvlpqfkvdgkvvfdrsmdwatgftqtlepraqylyvpyrnqddi
    yiydttlmqsdysglfrdrtysgldriasanqvstgltsriyddarverfnvsvgqiyyf
    srsrtgntnatgslvwagdtfwrindqlglkggaqydtrlgsltlgnaimeyrkdadrmi
    qlnyryaspkyiqaavpkvynpdyqqgisqvgttaswpiadrwaivgayyydtkakqpas
    qlvglqyntccwavnlgyerkitgwnaqgqtskydnkigfnietaqmlnsgilpyqsaf
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >5ixmH (H:)
    apntsgfnlrgttqvptelqklllessdpygplarsirqqlrlnnvtivddamrkdiptl
    riigssesqetvsifrngvaaenqlvlhvqaqvlipghdiyplqvnvfrtffdnpltala
    keaeaevlrqemreqaaqqlvrqlltvhaaevkntqkngdkpvsdanaaqgstptavnet
    tlgepavstsakhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5ixmH (H:)
    fnlrgttqvptelqklllessdpygplarsirqqlrlnnvtivddamrkdiptlriigss
    esqetvsifrngvaaenqlvlhvqaqvlipghdiyplqvnvfrtffdnpltalakeaeae
    vlrqemreqaaqqlvrqlltvhaaevk