PDB entry 5ixi

View 5ixi on RCSB PDB site
Description: structure of human jak1 ferm/sh2 in complex with ifnlr1/il10ra chimera
Deposited on 2016-03-23, released 2016-05-18
The last revision was dated 2016-06-15, with a file datestamp of 2016-06-10.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase JAK1
    Species: Homo sapiens [TaxId:9606]
    Gene: JAK1, JAK1A, JAK1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23458
      • conflict (349)
  • Chain 'B':
    Compound: Chimera protein of Interferon lambda receptor 1 and Interleukin-10 receptor subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: IL10RA, IL10R
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ixiA (A:)
    mhhhhhhgenlyfqgsgvevifylsdreplrlgsgeytaeelciraaqacrisplchnlf
    alydentklwyapnrtitvddkmslrlhyrmrfyftnwhgtndneqsvwrhspkkqkngy
    ekkkipdatplldassleylfaqgqydlvkclapirdpkteqdghdieneclgmavlais
    hyammkkmqlpelpkdisykryipetlnksirqrnlltrmrinnvfkdflkefnnkticd
    ssvsthdlkvkylatletltkhygaeifetsmllissenemnwfhsndggnvlyyevmvt
    gnlgiqwrhkpnvvsvekeknklkrkklenkdkkdeeknkireewnnfsffpeithivik
    esvvsinkqdnkkmelklssheealsfvslvdgyfrltadahhylctdvapplivhniqn
    gchgpicteyainklrqegseegmyvlrwsctdfdnilmtvtcfekseqvqgaqkqfknf
    qievqkgryslhgsdrsfpslgdlmshlkkqilrtdnisfmlkrccqpkpreisnllvat
    kgns
    

    Sequence, based on observed residues (ATOM records):
    >5ixiA (A:)
    vevifylsdreplrlgsgeytaeelciraaqacrisplchnlfalydentklwyapnrti
    tvmslrlhyrmrfyftnwhgtndneqsvwrhsptplldassleylfaqgqydlvkclapi
    rdpkteqdghdieneclgmavlaishyammkkmsykryipetlnksirqrnlltrmrinn
    vfkdflkefnnkticdssvsthdlkvkylatletltkhygaeifetsmllissenemnwf
    hsvlyyevmvtgnlgiqwrhkpeewnnfsffpeithivikesvvsinkqdnkkmelklss
    heealsfvslvdgyfrltadahhylctdvapplivhniqngchgpicteyainklrqeyv
    lrwsctdfdnilmtnfqievqkgryslhgsdrsfpslgdlmshlkkqilrtdnisfmlkr
    ccqpkpreisnllvat
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5ixiB (B:)
    gsktlmgnpwfqrkklpsvllfkkpspfifisqrpspetqdtihpldeeaflk
    

    Sequence, based on observed residues (ATOM records):
    >5ixiB (B:)
    tlmgnpwfqrkklpsvllfkkpspfifis