PDB entry 5ixe

View 5ixe on RCSB PDB site
Description: 1.75A RESOLUTION STRUCTURE OF 5-Fluoroindole BOUND BETA-GLYCOSIDASE (W33G) FROM SULFOLOBUS SOLFATARICUS
Class: hydrolase
Keywords: glycoside hydrolase, allosteric activation, switchable enzyme, chemical rescue, hydrolase
Deposited on 2016-03-23, released 2016-07-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-07-20, with a file datestamp of 2016-07-15.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-galactosidase
    Species: Sulfolobus solfataricus [TaxId:273057]
    Gene: lacS, SSO3019
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22498 (0-488)
      • engineered mutation (32)
    Domains in SCOPe 2.06: d5ixea_
  • Chain 'B':
    Compound: beta-galactosidase
    Species: Sulfolobus solfataricus [TaxId:273057]
    Gene: lacS, SSO3019
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22498 (0-488)
      • engineered mutation (32)
    Domains in SCOPe 2.06: d5ixeb_
  • Heterogens: 14O, MPD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ixeA (A:)
    mysfpnsfrfgwsqagfqsemgtpgsedpntdgykwvhdpenmaaglvsgdlpengpgyw
    gnyktfhdnaqkmglkiarlnvewsrifpnplprpqnfdeskqdvteveinenelkrlde
    yankdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtv
    yefarfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramynii
    qaharaydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitr
    gnekivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfg
    weffpeglydvltkywnryhlymyvtengiaddadyqrpyylvshvyqvhrainsgadvr
    gylhwsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlns
    vppvkplrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ixeA (A:)
    mysfpnsfrfgwsqagfqsemgtpgsedpntdgykwvhdpenmaaglvsgdlpengpgyw
    gnyktfhdnaqkmglkiarlnvewsrifpnplprpqnfdeskqdvteveinenelkrlde
    yankdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtv
    yefarfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramynii
    qaharaydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitk
    ivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfgweff
    peglydvltkywnryhlymyvtengiaddadyqrpyylvshvyqvhrainsgadvrgylh
    wsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlnsvppv
    kplrh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ixeB (B:)
    mysfpnsfrfgwsqagfqsemgtpgsedpntdgykwvhdpenmaaglvsgdlpengpgyw
    gnyktfhdnaqkmglkiarlnvewsrifpnplprpqnfdeskqdvteveinenelkrlde
    yankdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtv
    yefarfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramynii
    qaharaydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitr
    gnekivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfg
    weffpeglydvltkywnryhlymyvtengiaddadyqrpyylvshvyqvhrainsgadvr
    gylhwsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlns
    vppvkplrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ixeB (B:)
    mysfpnsfrfgwsqagfqsemgtpgsedpntdgykwvhdpenmaaglvsgdlpengpgyw
    gnyktfhdnaqkmglkiarlnvewsrifpnplprpqnfdeskqdvteveinenelkrlde
    yankdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtv
    yefarfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramynii
    qaharaydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitr
    gnkivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfgw
    effpeglydvltkywnryhlymyvtengiaddadyqrpyylvshvyqvhrainsgadvrg
    ylhwsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlnsv
    ppvkplrh