PDB entry 5ixc

View 5ixc on RCSB PDB site
Description: human givd cytosolic phospholipase a2 in complex with methyl gamma- linolenyl fluorophosphonate
Deposited on 2016-03-23, released 2016-06-08
The last revision was dated 2016-06-22, with a file datestamp of 2016-06-17.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytosolic phospholipase A2 delta
    Species: Homo sapiens [TaxId:9606]
    Gene: PLA2G4D
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Cytosolic phospholipase A2 delta
    Species: Homo sapiens [TaxId:9606]
    Gene: PLA2G4D
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 7FA, BA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ixcA (A:)
    gamgseslspggppghpyqgeastcwqltvrvlearnlrwadllseadpyvilqlstapg
    mkfktktltdtshpvwneafrfliqsqvknvlelsiydedsvteddicfkvlydisevlp
    gkllrktfsqspqgeeeldveflmeetsdrpenlitnkvivarelscldvhldstgstav
    vadqdklelelvlkgsyedtqtsflgtasafrfhymaaletelsgrlrssrsngwngdns
    agyltvplrpltigkevtmdvpapnapgvrlqlkaegcpeelavhlgfnlcaeeqaflsr
    rkqvvakalkqalqldrdlqedevpvvgimatgggaramtslyghllalqklglldcvty
    fsgisgstwtmahlygdpewsqrdlegpiryarehlaksklevfsperlasyrrelelra
    eqghpttfvdlwalvlesmlhgqvmdqklsgqraalergqnplplylslnvkennletld
    fkewvefspyevgflkygafvppelfgseffmgrlmrripepricfleaiwsnifslnll
    dawydltssgeswkqhikdktrslekeplttsgtssrleaswlqpgtalaqafkgfltgr
    plhqrspnflqglqlhqdycshkdfstwadyqldsmpsqltpkeprlclvdaayfintss
    psmfrpgrrldlilsfdyslsapfealqqtelycrarglpfprvepspqdqhqprechlf
    sdpacpeapillhfplvnasfkdhsapgvqrspaelqggqvdltgatcpytlsnmtykee
    dferllrlsdynvqtsqgailqalrtalkhrtle
    

    Sequence, based on observed residues (ATOM records):
    >5ixcA (A:)
    qgeastcwqltvrvlearnlrwadllseadpyvilqlstapgmkfktktltdtshpvwne
    afrfliqsqvknvlelsiydedsvteddicfkvlydisevlpgkllrktfseeeldvefl
    meetsdrpenlitnkvivarelscldvhldelelvlkgsyedtqtsflgtasafrfhyma
    aletelsgrlagyltvplrpltigkevtmdvpapnapgvrlqlkaegcpeelavhlgfnl
    caeeqaflsrrkqvvakalkqalqldrdlqedevpvvgimatgggaramtslyghllalq
    klglldcvtyfsgisgstwtmahlygdpewsqrdlegpiryarehlaksklevfsperla
    syrrelelraeqghpttfvdlwalvlesmlhgqvmdqklsgqraalergqnplplylsln
    vkewvefspyevgflkygafvppelfgseffmgrlmrripepricfleaiwsnifslnll
    easwlqpgtalaqafkgfrspnflqglqlhqdypkeprlclvdaayfintsspsmfrpgr
    rldlilsfdyslsapfealqqtelycrarglpfprvepspqdqhqprechlfsdpacpea
    pillhfplvnasfkdhsapgvqrspaelqggqvdltgatcpytlsnmtykeedferllrl
    sdynvqtsqgailqalrtalkhrt
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5ixcB (B:)
    gamgseslspggppghpyqgeastcwqltvrvlearnlrwadllseadpyvilqlstapg
    mkfktktltdtshpvwneafrfliqsqvknvlelsiydedsvteddicfkvlydisevlp
    gkllrktfsqspqgeeeldveflmeetsdrpenlitnkvivarelscldvhldstgstav
    vadqdklelelvlkgsyedtqtsflgtasafrfhymaaletelsgrlrssrsngwngdns
    agyltvplrpltigkevtmdvpapnapgvrlqlkaegcpeelavhlgfnlcaeeqaflsr
    rkqvvakalkqalqldrdlqedevpvvgimatgggaramtslyghllalqklglldcvty
    fsgisgstwtmahlygdpewsqrdlegpiryarehlaksklevfsperlasyrrelelra
    eqghpttfvdlwalvlesmlhgqvmdqklsgqraalergqnplplylslnvkennletld
    fkewvefspyevgflkygafvppelfgseffmgrlmrripepricfleaiwsnifslnll
    dawydltssgeswkqhikdktrslekeplttsgtssrleaswlqpgtalaqafkgfltgr
    plhqrspnflqglqlhqdycshkdfstwadyqldsmpsqltpkeprlclvdaayfintss
    psmfrpgrrldlilsfdyslsapfealqqtelycrarglpfprvepspqdqhqprechlf
    sdpacpeapillhfplvnasfkdhsapgvqrspaelqggqvdltgatcpytlsnmtykee
    dferllrlsdynvqtsqgailqalrtalkhrtle
    

    Sequence, based on observed residues (ATOM records):
    >5ixcB (B:)
    qgeastcwqltvrvlearnlrwadllseadpyvilqlstapgmkfktktltdtshpvwne
    afrfliqsqvknvlelsiydedsvteddicfkvlydisevlpgkllrktfseeeldvefl
    meetsdrpenlitnkvivarelscldvhldelelvlkgsyedtqtsflgtasafrfhyma
    aletelsgrlagyltvplrpltigkevtmdvpapnapgvrlqlkaegcpeelavhlgfnl
    caeeqaflsrrkqvvakalkqalqldrdlqedevpvvgimatgggaramtslyghllalq
    klglldcvtyfsgisgstwtmahlygdpewsqrdlegpiryarehlaksklevfsperla
    syrrelelraeqghpttfvdlwalvlesmlhgqvmdqklsgqraalergqnplplylsln
    vkewvefspyevgflkygafvppelfgseffmgrlmrripepricfleaiwsnifslnas
    wlqpgtalaqafrspnflqglqlhqdypkeprlclvdaayfintsspsmfrpgrrldlil
    sfdyslsapfealqqtelycrarglpfprvepspqdqhqprechlfsdpacpeapillhf
    plvnasfkdhsapgvqrspaelqggqvdltgatcpytlsnmtykeedferllrlsdynvq
    tsqgailqalrtalkhrtle