PDB entry 5iwz

View 5iwz on RCSB PDB site
Description: synaptonemal complex protein
Deposited on 2016-03-23, released 2017-03-29
The last revision was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Synaptonemal complex protein 2
    Species: Mus musculus [TaxId:10090]
    Gene: Sycp2, Scp2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9CUU3 (3-392)
      • expression tag (393-396)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5iwzA (A:)
    pgsmpvrpdlqqlekciddalrkndfkpllallqidicedvkikcskqflrklddlicre
    lnkkdiqtvssilisigrcsknifilgqaglqtmikqglvqkmvswfenskeiilnqqqs
    kdeavmnmiedlfdllmviydisdegknqvlesfipqicalvidsrvnfciqqealkkmn
    lmldripqdankilsnqemltlmsnmgerildvgdyelqvgivealcrmttekrrqelay
    ewfsmdfianafkeikdcefetdcriflnlvngilgdkrrvytfpclsaflgkyelqips
    dekleefwidfnlgshtlsfyiagdeedhqweavtvpeekvqmynievreskklltltlk
    nivkiskkegkellfyfdesleitnvtkkvfgglehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5iwzA (A:)
    mpvrpdlqqlekciddalrkndfkpllallqidicedvkikcskqflrklddlicrelnk
    kdiqtvssilisigrcsknifilgqaglqtmikqglvqkmvswfenskeiilnqdeavmn
    miedlfdllmviydisdegknqvlesfipqicalvidsrvnfciqqealkkmnlmldrin
    qemltlmsnmgerildvgdyelqvgivealcrmttekrrqelayewfsmdfianafkeik
    dcefetdcriflnlvngilgdkrrvytfpclsaflgkyelqipsdekleefwidfnlgsh
    tlsfyieavtvpeekvqmynievreskklltltlknivkiskkegkellfyfdesleitn
    vtkkvfgglehh