PDB entry 5iwl

View 5iwl on RCSB PDB site
Description: CD47-diabody complex
Class: cell adhesion
Keywords: receptor, diabody, complex, CELL ADHESION
Deposited on 2016-03-22, released 2016-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-13, with a file datestamp of 2016-07-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5F9 diabody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IWL (0-End)
    Domains in SCOPe 2.07: d5iwla1, d5iwla2
  • Chain 'B':
    Compound: 5F9 diabody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IWL (0-End)
    Domains in SCOPe 2.07: d5iwlb1, d5iwlb2
  • Chain 'C':
    Compound: leukocyte surface antigen cd47
    Species: Homo sapiens [TaxId:9606]
    Gene: CD47, MER6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08722 (0-113)
      • conflict (10)
      • engineered mutation (14)
  • Chain 'D':
    Compound: leukocyte surface antigen cd47
    Species: Homo sapiens [TaxId:9606]
    Gene: CD47, MER6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08722 (0-113)
      • conflict (10)
      • engineered mutation (14)
  • Heterogens: NAG, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5iwlA (A:)
    evqlvqsgaevkkpgasvkvsckasgytftnynmhwvrqapgqrlewmgtiypgnddtsy
    nqkfkdrvtitadtsastaymelsslrsedtavyycarggyramdywgqgtlvtvssggs
    ggdivmtqsplslpvtpgepasiscrssqsivysngntylgwylqkpgqspqlliykvsn
    rfsgvpdrfsgsgsgtdftlkisrveaedvgvyycfqgshvpytfgqgtkleik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iwlA (A:)
    evqlvqsgaevkkpgasvkvsckasgytftnynmhwvrqapgqrlewmgtiypgnddtsy
    nqkfkdrvtitadtsastaymelsslrsedtavyycarggyramdywgqgtlvtvssggs
    ggdivmtqsplslpvtpgepasiscrssqsivysngntylgwylqkpgqspqlliykvsn
    rfsgvpdrfsgsgsgtdftlkisrveaedvgvyycfqgshvpytfgqgtklei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5iwlB (B:)
    evqlvqsgaevkkpgasvkvsckasgytftnynmhwvrqapgqrlewmgtiypgnddtsy
    nqkfkdrvtitadtsastaymelsslrsedtavyycarggyramdywgqgtlvtvssggs
    ggdivmtqsplslpvtpgepasiscrssqsivysngntylgwylqkpgqspqlliykvsn
    rfsgvpdrfsgsgsgtdftlkisrveaedvgvyycfqgshvpytfgqgtkleik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iwlB (B:)
    evqlvqsgaevkkpgasvkvsckasgytftnynmhwvrqapgqrlewmgtiypgnddtsy
    nqkfkdrvtitadtsastaymelsslrsedtavyycarggyramdywgqgtlvtvssggs
    ggdivmtqsplslpvtpgepasiscrssqsivysngntylgwylqkpgqspqlliykvsn
    rfsgvpdrfsgsgsgtdftlkisrveaedvgvyycfqgshvpytfgqgtklei
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.