PDB entry 5iwe

View 5iwe on RCSB PDB site
Description: E45Q mutant of phenazine biosynthesis protein PhzF in complex with (5R,6R)-6-azaniumyl-5-ethoxycyclohexa-1,3-diene-1-carboxylate
Class: isomerase
Keywords: Isomerase, complex, substrate analogue
Deposited on 2016-03-22, released 2017-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trans-2,3-dihydro-3-hydroxyanthranilate isomerase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: PHZF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51792 (20-297)
      • expression tag (19)
      • engineered mutation (64)
    Domains in SCOPe 2.07: d5iwea1, d5iwea2, d5iwea3
  • Heterogens: W81, PEG, EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5iweA (A:)
    mgsshhhhhhssglvprgshmhnyviidafasvplegnpvavffdaddlppaqmqriare
    mnlsqstfvlkprnggdaliriftpvnelpfaghpllgtaialgahtdnhrlyletqmgt
    iafelerqngsviaasmdqpiptwtalgrdaellkalgisdstfpieiyhngprhvfvgl
    psidalsalhpdhralsnfhdmaincfagagrrwrsrmfspaygvvedaatgsaagplai
    hlarhgqiefgqpveilqgveigrpslmfakaegraeqltrvevsgngvtfgrgtivl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iweA (A:)
    hmhnyviidafasvplegnpvavffdaddlppaqmqriaremnlsqstfvlkprnggdal
    iriftpvnelpfaghpllgtaialgahtdnhrlyletqmgtiafelerqngsviaasmdq
    piptwtalgrdaellkalgisdstfpieiyhngprhvfvglpsidalsalhpdhralsnf
    hdmaincfagagrrwrsrmfspaygvvedaatgsaagplaihlarhgqiefgqpveilqg
    veigrpslmfakaegraeqltrvevsgngvtfgrgtivl