PDB entry 5iw9

View 5iw9 on RCSB PDB site
Description: structure of bacteriophage t4 gp25, sheath polymerization initiator
Deposited on 2016-03-22, released 2016-05-11
The last revision was dated 2016-06-08, with a file datestamp of 2016-06-03.
Experiment type: XRAY
Resolution: 2.47 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Baseplate wedge protein gp25
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: 25
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Baseplate wedge protein gp25
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: 25
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5iw9A (A:)
    aninklysdidpemkmdwnkdvsrslglrsiknsllgiittrkgsrpfdpefgcdlsdql
    fenmtpltadtverniesavrnyepridklavnvipvyddytliveirfsvidnpddieq
    iklqlassnrv
    

    Sequence, based on observed residues (ATOM records):
    >5iw9A (A:)
    ninklysdidpemkmdwnkdvsrslglrsiknsllgiittrkgsrpfdpefgcdlsdqlf
    enmtpltadtverniesavrnyepridklavnvipvyddytliveirfsvidnpddieqi
    klqlas
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5iw9B (B:)
    aninklysdidpemkmdwnkdvsrslglrsiknsllgiittrkgsrpfdpefgcdlsdql
    fenmtpltadtverniesavrnyepridklavnvipvyddytliveirfsvidnpddieq
    iklqlassnrv
    

    Sequence, based on observed residues (ATOM records):
    >5iw9B (B:)
    nklysdidpemkmdwnkdvsrslglrsiknsllgiittrkgsrpfdpefgcdlsdqlfen
    mtpltadtverniesavrnyepridklavnvipvyddytliveirfsvidnpddieqikl
    qlass