PDB entry 5iw4

View 5iw4 on RCSB PDB site
Description: crystal structure of e. coli nudc in complex with nad
Deposited on 2016-03-22, released 2016-07-13
The last revision was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADH pyrophosphatase
    Species: Escherichia coli B354 [TaxId:550677]
    Gene: nudC
    Database cross-references and differences (RAF-indexed):
    • Uniprot D6JHV3 (1-End)
      • expression tag (0)
  • Chain 'B':
    Compound: NADH pyrophosphatase
    Species: Escherichia coli B354 [TaxId:550677]
    Gene: nudC
    Database cross-references and differences (RAF-indexed):
    • Uniprot D6JHV3 (1-257)
      • expression tag (0)
  • Heterogens: ZN, NAD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5iw4A (A:)
    smdriiekldhgwwvvsheqklwlpkgelpygeaanfdlvgqralqigewqgepvwlvqq
    qrrhdmgsvrqvidldvglfqlagrgvqlaefyrshkycgycghemypsktewamlcshc
    reryypqiapciivairrddsillaqhtrhrngvhtvlagfvevgetleqavarevmees
    gikvknlryvtsqpwpfpqslmtafmaeydsgdividpkelleanwyryddlpllpppgt
    varrliedtvamcraeye
    

    Sequence, based on observed residues (ATOM records):
    >5iw4A (A:)
    smdriiekldhgwwvvsheqklwlpkgelpygeaanfdlvgqralqigewqgepvwlvqq
    qrrhdmgsvrqvidldvglfqlagrgvqlaefyrshkycgycghemypsktewamlcshc
    reryypqiapciivairrddsillaqhtrhrngvhtvlagfvevgetleqavarevmees
    gikvknlryvtsqpwpfpqslmtafmaeydsgdividpkelleanwyryddlpllpppgt
    varrliedtvamcraey
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >5iw4B (B:)
    smdriiekldhgwwvvsheqklwlpkgelpygeaanfdlvgqralqigewqgepvwlvqq
    qrrhdmgsvrqvidldvglfqlagrgvqlaefyrshkycgycghemypsktewamlcshc
    reryypqiapciivairrddsillaqhtrhrngvhtvlagfvevgetleqavarevmees
    gikvknlryvtsqpwpfpqslmtafmaeydsgdividpkelleanwyryddlpllpppgt
    varrliedtvamcraeye