PDB entry 5iw3

View 5iw3 on RCSB PDB site
Description: anti-CD20 monoclonal antibody Fc fragment
Class: immune system
Keywords: Glycosylation, IMMUNE SYSTEM
Deposited on 2016-03-21, released 2017-03-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857 (0-207)
      • engineered mutation (120)
      • engineered mutation (122)
    Domains in SCOPe 2.06: d5iw3a1, d5iw3a2
  • Heterogens: NAG, BMA, MAN, GAL, SO4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5iw3A (A:)
    ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
    ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsr
    eemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdks
    rwqqgnvfscsvmhealhnhytqkslsl