PDB entry 5ivl

View 5ivl on RCSB PDB site
Description: csha helicase
Deposited on 2016-03-21, released 2017-03-22
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DEAD-box ATP-dependent RNA helicase CshA
    Species: Geobacillus stearothermophilus 10 [TaxId:272567]
    Gene: cshA, GT50_10605
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0K2H973 (Start-421)
      • expression tag (422-423)
  • Chain 'B':
    Compound: DEAD-box ATP-dependent RNA helicase CshA
    Species: Geobacillus stearothermophilus 10 [TaxId:272567]
    Gene: cshA, GT50_10605
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0K2H973 (Start-421)
      • expression tag (422-424)
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ivlA (A:)
    mttfqelglsqevmkaiermgfeettpiqaktiplslqnkdvigqaqtgtgktaafgipi
    vekvdvkngaiqalvvaptrelaiqvseelykigavkrvrvlpiyggqdierqiralkkh
    phvivgtpgriidhinrgtlrlehvhtvvldeademlnmgfiedieailshvpaerqtll
    fsatmpdpirriaerfmnepelvkvkakemtvpniqqyylevhekkkfdiltrlldiqap
    elaivfgrtkrrvdelaealnlrgyaaegihgdlsqakrlsvlrkfkegaieilvatdva
    argldisgvthvynfdipqdpesyvhrigrtgragktgvamtfvtpreigqlhhierttk
    rkmermkpptldealegqqriaiekllnvvetenlsfykraaeelleehdsvtivaaclk
    mlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5ivlA (A:)
    sqevmkaiermgfeettpiqaktiplslqnkdvigqaqtgtgktaafgipivekvdvkng
    aiqalvvaptrelaiqvseelykigavkrvrvlpiyggqdierqiralkkhphvivgtpg
    riidhinrgtlrlehvhtvvldeademlnmgfiedieailshvpaerqtllfsatmpdpi
    rriaerfmnepelvkvkpniqqyylevhekkkfdiltrlldiqapelaivfgrtkrrvde
    laealnlrgyaaegihgdlsqakrlsvlrkfkegaieilvatdvaargldisgvthvynf
    dipqdpesyvhrigrtgrgvamtfvtpreigqlhhierttkrkmermkpptldealegqq
    riaiekllnvvetenlsfykraaeelleedsvtivaaclkmleh
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5ivlB (B:)
    mttfqelglsqevmkaiermgfeettpiqaktiplslqnkdvigqaqtgtgktaafgipi
    vekvdvkngaiqalvvaptrelaiqvseelykigavkrvrvlpiyggqdierqiralkkh
    phvivgtpgriidhinrgtlrlehvhtvvldeademlnmgfiedieailshvpaerqtll
    fsatmpdpirriaerfmnepelvkvkakemtvpniqqyylevhekkkfdiltrlldiqap
    elaivfgrtkrrvdelaealnlrgyaaegihgdlsqakrlsvlrkfkegaieilvatdva
    argldisgvthvynfdipqdpesyvhrigrtgragktgvamtfvtpreigqlhhierttk
    rkmermkpptldealegqqriaiekllnvvetenlsfykraaeelleehdsvtivaaclk
    mlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5ivlB (B:)
    fqelglsqevmkaiermgfeettpiqaktiplslqnkdvigqaqtgtgktaafgipivek
    vdvkngaiqalvvaptrelaiqvseelykigavkrvrvlpiyggqdierqiralkkhphv
    ivgtpgriidhinrgtlrlehvhtvvldeademlgfiedieailshvpaerqtllfsatm
    pdpirriaerfmnepelvkvkavpniqqyylevhekkkfdiltrlldiqapelaivfgrt
    krrvdelaealnlrgyaaegihgdlsqakrlsvlrkfkegaieilvatdvaargldisgv
    thvynfdipqdpesyvhrigrtgragktgvamtfvtpreigqlhhierttkrkmermkpp
    tldealegqqriaiekllnvvetefykraaeelleehdsvtivaaclkmlehh