PDB entry 5ivf

View 5ivf on RCSB PDB site
Description: linked kdm5a jmj domain bound to the inhibitor n10 8-(1-methyl-1h- imidazol-4-yl)-2-(4,4,4-trifluorobutoxy)pyrido[3,4-d]pyrimidin-4-ol
Deposited on 2016-03-20, released 2016-07-27
The last revision was dated 2016-08-03, with a file datestamp of 2016-07-29.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysine-specific demethylase 5A
    Species: Homo sapiens [TaxId:9606]
    Gene: KDM5A, JARID1A, RBBP2, RBP2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 6EB, MN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ivfA (A:)
    hnmagvgpggyaaefvpppecpvfepsweeftdplsfigrirplaektgickirppkdwq
    ppfacevksfrftprvqrlneleamtrvrpreafgfeqavreytlqsfgemadnfksdyf
    nmpvhmvptelvekefwrlvssieedviveygadisskdfgsgfpvkdgrrkilpeeeey
    alsgwnlnnmpvleqsvlahinvdisgmkvpwlyvgmcfssfcwhiedhwsysinylhwg
    epktwygvpshaaeqleevmrelapelfesqpdllhqlvtimnpnvlmehgvpvyrtnqc
    agefvvtfprayhsgfnqgynfaeavnfct
    

    Sequence, based on observed residues (ATOM records):
    >5ivfA (A:)
    efvpppecpvfepsweeftdplsfigrirplaektgickirppkdwqppfacevksfrft
    prvqrlneleamrpreafgfeqavreytlqsfgemadnfksdyfnmpvhmvptelvekef
    wrlvssieedviveygadisskdfgsgfpvkdgrrkilpeeeeyalsgwnlnnmpvleqs
    vlahinkvpwlyvgmcfssfcwhiedhwsysinylhwgepktwygvpshaaeqleevmre
    lapelfesqpdllhqlvtimnpnvlmehgvpvyrtnqcagefvvtfprayhsgfnqgynf
    aeavnfct