PDB entry 5ivd

View 5ivd on RCSB PDB site
Description: the alpha-esterase-7 carboxylesterase, e3, from the blowfly lucilia cuprina: apo-enzyme qfit multi-conformer model
Deposited on 2016-03-20, released 2016-06-15
The last revision was dated 2016-06-22, with a file datestamp of 2016-06-17.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carboxylic ester hydrolase
    Species: Lucilia cuprina [TaxId:7375]
    Gene: LcaE7
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q25252 (Start-576)
      • conflict (89)
      • conflict (370)
      • conflict (425)
      • conflict (478)
      • conflict (511)
      • conflict (536)
      • conflict (560)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ivdA (A:)
    mhhhhhhmnfnvslmeklkwkikcienkflnyrlttnetvvaeteygkvkgvkrltvydd
    syysfegipyaqppvgelrfkapqrptpwagvrdccnhkdksvqvdfitgkvcgsedcly
    lsvytnnlnpetkrpvlvyihgggfiigenhrdmygpdyfikkdvvliniqyrlgalgfl
    slnsedlnvpgnaglkdqvmalrwiknncanfggnpdnitvfgesagaasthymmlteqt
    rglfhrgilmsgnaicpwantqcqhraftlaklagykgedndkdvleflmkakpqdlikl
    eekvltleertnkvmfpfgptvepyqtadcvlpkhpremvktawgnsiptmmgntsyegl
    fftsilkqmpllvkeletcvnfvpseladaertapetlemgakikkahvtgetptadnfm
    dlcshfyfwfpmhrllqlrfnhtsgtpvylyrfdfdsedlinpyrimrsgrgvkgvshtd
    eltyffwnqlakrmpkesreyktiermtgiwtqfattgnpysneiegmenvswdpieksd
    evykclnisdelkmidvpemgkikqwesmfekhrdlf
    

    Sequence, based on observed residues (ATOM records):
    >5ivdA (A:)
    vslmeklkwkikcienkflnyrlttnetvvaeteygkvkgvkrltvyddsyysfegipya
    qppvgelrfkapqrptpwagvrdccnhkdksvqvdfitgkvcgsedclylsvytnnlnpe
    tkrpvlvyihgggfiigenhrdmygpdyfikkdvvliniqyrlgalgflslnsedlnvpg
    naglkdqvmalrwiknncanfggnpdnitvfgesagaasthymmlteqtrglfhrgilms
    gnaicpwantqcqhraftlaklagykgedndkdvleflmkakpqdlikleekvltleert
    nkvmfpfgptvepyqtadcvlpkhpremvktawgnsiptmmgntsyeglfftsilkqmpl
    lvkeletcvnfvpseladaertapetlemgakikkahvtgetptadnfmdlcshfyfwfp
    mhrllqlrfnhtsgtpvylyrfdfdsedlinpyrimrsgrgvkgvshtdeltyffwnqla
    krmpkesreyktiermtgiwtqfattgnpysneiegmenvswdpieksdevykclnisde
    lkmidvpemgkikqwesmfekhrdlf