PDB entry 5ivc

View 5ivc on RCSB PDB site
Description: linked kdm5a jmj domain bound to the inhibitor n3 (4'-[(2- phenylethyl)carbamoyl][2,2'-bipyridine]-4-carboxylic acid)
Deposited on 2016-03-20, released 2016-07-27
The last revision was dated 2016-08-03, with a file datestamp of 2016-07-29.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysine-specific demethylase 5A
    Species: Homo sapiens [TaxId:9606]
    Gene: KDM5A, JARID1A, RBBP2, RBP2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 6E7, MN, EDO, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ivcA (A:)
    hnmagvgpggyaaefvpppecpvfepsweeftdplsfigrirplaektgickirppkdwq
    ppfacevksfrftprvqrlneleamtrvrpreafgfeqavreytlqsfgemadnfksdyf
    nmpvhmvptelvekefwrlvssieedviveygadisskdfgsgfpvkdgrrkilpeeeey
    alsgwnlnnmpvleqsvlahinvdisgmkvpwlyvgmcfssfcwhiedhwsysinylhwg
    epktwygvpshaaeqleevmrelapelfesqpdllhqlvtimnpnvlmehgvpvyrtnqc
    agefvvtfprayhsgfnqgynfaeavnfct
    

    Sequence, based on observed residues (ATOM records):
    >5ivcA (A:)
    efvpppecpvfepsweeftdplsfigrirplaektgickirppkdwqppfacevksfrft
    prvqrlneleamrpreafgfeqavreytlqsfgemadnfksdyfnmpvhmvptelvekef
    wrlvssieedviveygadisskdfgsgfpvkdgrrkilpeeeeyalsgwnlnnmpvleqs
    vlahinkvpwlyvgmcfssfcwhiedhwsysinylhwgepktwygvpshaaeqleevmre
    lapelfesqpdllhqlvtimnpnvlmehgvpvyrtnqcagefvvtfprayhsgfnqgynf
    aeavnfct