PDB entry 5iv4

View 5iv4 on RCSB PDB site
Description: crystal structure of the human soluble cyclase in complex with the allosteric inhibitor lre1
Deposited on 2016-03-18, released 2016-08-17
The last revision was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylate cyclase type 10
    Species: Homo sapiens [TaxId:9606]
    Gene: ADCY10, SAC
    Database cross-references and differences (RAF-indexed):
  • Heterogens: LRI, ACT, EDO, DMS, CL, PEG, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5iv4A (A:)
    mntpkeefqdwpivriaahlpdlivyghfsperpfmdyfdgvlmfvdisgftamtekfss
    amymdrgaeqlveilnyhisaivekvlifggdilkfagdallalwrverkqlkniitvvi
    kcsleihglfetqeweegldirvkiglaaghismlvfgdethshflvigqavddvrlaqn
    maqmndvilspncwqlcdrsmieiesvpdqravkvnflkpppnfnfdefftkcttfmhyy
    psgehknllrlactlkpdpelemslqkyvmesilkqidnkqlqgylselrpvtivfvnlm
    fedqdkaeeigpaiqdaymhitsvlkifqgqinkvfmfdkgcsflcvfgfpgekvpdelt
    halecamdifdfcsqvhkiqtvsigvasgivfcgivghtvrheytvigqkvnlaarmmmy
    ypgivtcdsvtyngsnlpayffkelpkkvmkgvadsgplyqywgrtekvhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5iv4A (A:)
    efqdwpivriaahlpdlivyghfsperpfmdyfdgvlmfvdisgftamtekfssamymdr
    gaeqlveilnyhisaivekvlifggdilkfagdallalwrverkqlkniitvvikcslei
    hglfetqeweegldirvkiglaaghismlvfgdethshflvigqavddvrlaqnmaqmnd
    vilspncwqlcdrsmieiesvpdqravkvnflkpppnfnfdefftkcttfmhyypsgehk
    nllrlactlkpdpelemslqkyvmesilkqidnkqlqgylselrpvtivfvnlmfedqdk
    aeeigpaiqdaymhitsvlkifqgqinkvfmfdkgcsflcvfgfpgekvdelthalecam
    difdfcsqvhkiqtvsigvasgivfcgivghtvrheytvigqkvnlaarmmmyypgivtc
    dsvtyngsnlpayffkelpkkvmkgvadsgplyqywgrtek