PDB entry 5iv0

View 5iv0 on RCSB PDB site
Description: crystal structure of eis from mycobacterium tuberculosis in complex with sulfonamide inhibitor 39 and coenzyme a
Deposited on 2016-03-18, released 2017-01-11
The last revision was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enhanced intracellular survival protein
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: eis, MT2489
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WFK6 (Start-427)
      • engineered mutation (229)
  • Heterogens: COA, 6E9, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5iv0A (A:)
    mgsshhhhhhssglvprgshmlqsdsmtvtlcspteddwpgmfllaaasftdfigpesat
    awrtlvptdgavvvrdgagpgsevvgmalymdlrltvpgevvlptaglsfvavapthrrr
    gllramcaelhrriadsgypvaalhaseggiygrfgygpattlheltvdrrfarfhadap
    ggglggssvrlvrptehrgefeaiyerwrqqvpggllrpqvlwdellaeakaapggdres
    fallhpdgyalyrvdrtdlklarvselravtadahcalwraligldsmerisiithpqdp
    lphlltdtrlarttwrqdglwlrimnvpaaleargyahevgefstvlevsdggrfalkig
    dgrarctptdaaaeiemdrdvlgslylgahrastlaaanrlrtkdsqllrrldaafasdv
    pvqtafef
    

    Sequence, based on observed residues (ATOM records):
    >5iv0A (A:)
    vtlcspteddwpgmfllaaasftdfigpesatawrtlvptdgavvvrdgsevvgmalymd
    lrltvpgevvlptaglsfvavapthrrrgllramcaelhrriadsgypvaalhaseggiy
    grfgygpattlheltvdrrfarfhadapggglggssvrlvrptehrgefeaiyerwrqqv
    pggllrpqvlwdellaeakaapggdresfallhpdgyalyrvdrtdlklarvselravta
    dahcalwraligldsmerisiithpqdplphlltdtrlarttwrqdglwlrimnvpaale
    argyahevgefstvlevsdggrfalkigdgrarctptdaaaeiemdrdvlgslylgahra
    stlaaanrlrtkdsqllrrldaafasdvpvqtafef