PDB entry 5iul

View 5iul on RCSB PDB site
Description: Crystal structure of the DesK-DesR complex in the phosphotransfer state with high Mg2+ (150 mM) and BeF3
Class: transferase
Keywords: Two-component regulatory system, Kinase, Response regulator, Phosphotransfer complex, Phosphotransfer, TRANSFERASE
Deposited on 2016-03-18, released 2016-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sensor histidine kinase desK
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: desK, yocF, BSU19190
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34757
      • engineered mutation (35)
  • Chain 'B':
    Compound: Sensor histidine kinase desK
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: desK, yocF, BSU19190
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34757 (1-End)
      • engineered mutation (35)
  • Chain 'C':
    Compound: Transcriptional regulatory protein DesR
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: desR, yocG, BSU19200
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34723 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.07: d5iulc1, d5iulc2
  • Chain 'D':
    Compound: Sensor histidine kinase desK
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: desK, yocF, BSU19190
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34757
      • engineered mutation (35)
  • Chain 'E':
    Compound: Sensor histidine kinase desK
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: desK, yocF, BSU19190
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34757 (1-End)
      • engineered mutation (35)
  • Chain 'F':
    Compound: Transcriptional regulatory protein DesR
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: desR, yocG, BSU19200
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5iulf_
  • Heterogens: ACP, MG, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >5iulC (C:)
gsgsmisifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdie
mpgktgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsv
mngkriyapelmedlysea

    Sequence, based on observed residues (ATOM records): (download) 
    >5iulC (C:)
smisifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiempg
ktgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsvmng
kriyapelmedl

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download) 
    >5iulF (F:)
gsgsmisifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdie
mpgktgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsv
mngkriyapelmedlysea

    Sequence, based on observed residues (ATOM records): (download) 
    >5iulF (F:)
misifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiempgk
tgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsvmngk
riyapelmedly