PDB entry 5iuk

View 5iuk on RCSB PDB site
Description: Crystal structure of the DesK-DesR complex in the phosphotransfer state with high Mg2+ (150 mM)
Class: transferase/gene regulation
Keywords: Two-component regulatory system, Kinase, Response regulator, Phosphotransfer complex, Phosphotransfer, TRANSFERASE, TRANSFERASE-GENE REGULATION complex
Deposited on 2016-03-18, released 2016-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Sensor histidine kinase desK
  Species: BACILLUS SUBTILIS [TaxId:224308]
  Gene: desK, yocF, BSU19190
  Database cross-references and differences (RAF-indexed):
  • Uniprot O34757
    • engineered mutation (35)
• Chain 'B':
  Compound: Sensor histidine kinase desK
  Species: BACILLUS SUBTILIS [TaxId:224308]
  Gene: desK, yocF, BSU19190
  Database cross-references and differences (RAF-indexed):
  • Uniprot O34757 (1-End)
    • engineered mutation (35)
• Chain 'C':
  Compound: Transcriptional regulatory protein DesR
  Species: Bacillus subtilis (strain 168) [TaxId:224308]
  Gene: desR, yocG, BSU19200
  Database cross-references and differences (RAF-indexed):
  • Uniprot O34723 (4-End)
    • expression tag (3)
  Domains in SCOPe 2.07: d5iukc1, d5iukc2
• Chain 'D':
  Compound: Sensor histidine kinase desK
  Species: BACILLUS SUBTILIS [TaxId:224308]
  Gene: desK, yocF, BSU19190
  Database cross-references and differences (RAF-indexed):
  • Uniprot O34757
    • engineered mutation (35)
• Chain 'E':
  Compound: Sensor histidine kinase desK
  Species: BACILLUS SUBTILIS [TaxId:224308]
  Gene: desK, yocF, BSU19190
  Database cross-references and differences (RAF-indexed):
  • Uniprot O34757 (1-End)
    • engineered mutation (35)
• Chain 'F':
  Compound: Transcriptional regulatory protein DesR
  Species: Bacillus subtilis (strain 168) [TaxId:224308]
  Gene: desR, yocG, BSU19200
  Database cross-references and differences (RAF-indexed):
  • Uniprot O34723 (4-End)
    • expression tag (3)
  Domains in SCOPe 2.07: d5iukf1, d5iukf2
• Heterogens: ACP, MG, K, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >5iukC (C:)
  gsgsmisifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdie
  mpgktgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsv
  mngkriyapelmedlysea
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >5iukC (C:)
  smisifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiempg
  ktgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsvmng
  kriyapelmedl
  

  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  Sequence, based on SEQRES records: (download)
  

  >5iukF (F:)
  gsgsmisifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdie
  mpgktgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsv
  mngkriyapelmedlysea
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >5iukF (F:)
  smisifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiempg
  ktgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsvmng
  kriyapelmedly