PDB entry 5iuj

View 5iuj on RCSB PDB site
Description: crystal structure of the desk-desr complex in the phosphotransfer state with low mg2+ (20 mm)
Deposited on 2016-03-18, released 2016-12-21
The last revision was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sensor histidine kinase desK
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: desK, yocF, BSU19190
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34757
      • engineered mutation (35)
  • Chain 'B':
    Compound: Sensor histidine kinase desK
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: desK, yocF, BSU19190
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34757 (1-End)
      • engineered mutation (35)
  • Chain 'C':
    Compound: Transcriptional regulatory protein DesR
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: desR, yocG, BSU19200
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Sensor histidine kinase desK
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: desK, yocF, BSU19190
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34757 (1-End)
      • engineered mutation (35)
  • Chain 'E':
    Compound: Sensor histidine kinase desK
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: desK, yocF, BSU19190
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34757 (1-End)
      • expression tag (0)
      • engineered mutation (35)
  • Chain 'F':
    Compound: Transcriptional regulatory protein DesR
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: desR, yocG, BSU19200
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ACP, MG, K, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5iujA (A:)
    grkererleekledaneriaelvkleerqriardledtlgqklsliglksdlarkliykd
    peqaarelksvqqtartslnevrkivssmkgirlkdelinikqileaadimfiyeeekwp
    enisllnenilsmclkeavtnvvkhsqaktcrvdiqqlwkevvitvsddgtfkgeensfs
    kghgllgmrerlefangslhidtengtkltmaipnnsk
    

    Sequence, based on observed residues (ATOM records):
    >5iujA (A:)
    kererleekledaneriaelvkleerqriardledtlgqklsliglksdlarkliykdpe
    qaarelksvqqtartslnevrkivssmkgirlkdelinikqileaadimfiyeeekwpen
    isllnenilsmclkeavtnvvkhsqaktcrvdiqqlwkevvitvsddgtfkgeensfshg
    llgmrerlefangslhidtengtkltmaipn
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5iujB (B:)
    grkererleekledaneriaelvkleerqriardledtlgqklsliglksdlarkliykd
    peqaarelksvqqtartslnevrkivssmkgirlkdelinikqileaadimfiyeeekwp
    enisllnenilsmclkeavtnvvkhsqaktcrvdiqqlwkevvitvsddgtfkgeensfs
    kghgllgmrerlefangslhidtengtkltmaipnnsk
    

    Sequence, based on observed residues (ATOM records):
    >5iujB (B:)
    rkererleekledaneriaelvkleerqriardledtlgqklsliglksdlarkliykdp
    eqaarelksvqqtartslnevrkivssmkgirlkdelinikqileaadimfiyeeekwpe
    nisllnenilsmclkeavtnvvkhsqaktcrvdiqqlwkevvitvsddgtfkgeensfsk
    ghgllgmrerlefangslhidtengtkltmaipnn
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5iujC (C:)
    gsgsmisifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdie
    mpgktgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsv
    mngkriyapelmedlysea
    

    Sequence, based on observed residues (ATOM records):
    >5iujC (C:)
    misifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiempgk
    tgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsvmngk
    riyapelmedl
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5iujD (D:)
    grkererleekledaneriaelvkleerqriardledtlgqklsliglksdlarkliykd
    peqaarelksvqqtartslnevrkivssmkgirlkdelinikqileaadimfiyeeekwp
    enisllnenilsmclkeavtnvvkhsqaktcrvdiqqlwkevvitvsddgtfkgeensfs
    kghgllgmrerlefangslhidtengtkltmaipnnsk
    

    Sequence, based on observed residues (ATOM records):
    >5iujD (D:)
    rkererleekledaneriaelvkleerqriardledtlgqklsliglksdlarkliykdp
    eqaarelksvqqtartslnevrkivssmkgirlkdelinikqileaadimfiyeeekwpe
    nisllnenilsmclkeavtnvvkhsqaktcrvdiqqlwkevvitvsddgtfkgeensfsh
    gllgmrerlefangslhidtengtkltmaipnn
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5iujE (E:)
    grkererleekledaneriaelvkleerqriardledtlgqklsliglksdlarkliykd
    peqaarelksvqqtartslnevrkivssmkgirlkdelinikqileaadimfiyeeekwp
    enisllnenilsmclkeavtnvvkhsqaktcrvdiqqlwkevvitvsddgtfkgeensfs
    kghgllgmrerlefangslhidtengtkltmaipnnsk
    

    Sequence, based on observed residues (ATOM records):
    >5iujE (E:)
    grkererleekledaneriaelvkleerqriardledtlgqklsliglksdlarkliykd
    peqaarelksvqqtartslnevrkivssmkgirlkdelinikqileaadimfiyeeekwp
    enisllnenilsmclkeavtnvvkhsqaktcrvdiqqlwkevvitvsddgtfkgeensfs
    kghgllgmrerlefangslhidtengtkltmaipn
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5iujF (F:)
    gsgsmisifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdie
    mpgktgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsv
    mngkriyapelmedlysea
    

    Sequence, based on observed residues (ATOM records):
    >5iujF (F:)
    misifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiempgk
    tgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsvmngk
    riyapelmedlys