PDB entry 5iuc

View 5iuc on RCSB PDB site
Description: crystal structure of the gspb siglec domain with sialyl t antigen bound
Deposited on 2016-03-17, released 2016-04-13
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Platelet binding protein GspB
    Species: Streptococcus gordonii [TaxId:1302]
    Gene: gspB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q939N5 (4-126)
      • conflict (49)
  • Chain 'B':
    Compound: Platelet binding protein GspB
    Species: Streptococcus gordonii [TaxId:1302]
    Gene: gspB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q939N5 (4-126)
      • conflict (49)
  • Heterogens: MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5iucA (A:)
    gpgsdterpvvnvpseitvyrgesfeyfatvtdnsnafdlaktvvrwlysnqpgrgtewl
    qysvtqvgnqlkvrifgnvpidttigdytryvvatdaagnvnatqtemgnaavdktsvng
    qfkliir
    

    Sequence, based on observed residues (ATOM records):
    >5iucA (A:)
    dterpvvnvpseitvyrgesfeyfatvtdnsnafdlaktvvrwlysnqpgrgtewlqysv
    tqvgnqlkvrifgnvpidttigdytryvvatdaagnvnatqtemgnaavdktsvngqfkl
    iir
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5iucB (B:)
    gpgsdterpvvnvpseitvyrgesfeyfatvtdnsnafdlaktvvrwlysnqpgrgtewl
    qysvtqvgnqlkvrifgnvpidttigdytryvvatdaagnvnatqtemgnaavdktsvng
    qfkliir
    

    Sequence, based on observed residues (ATOM records):
    >5iucB (B:)
    dterpvvnvpseitvyrgesfeyfatvtdnsnafdlaktvvrwlysnqpgrgtewlqysv
    tqvgnqlkvrifgnvpidttigdytryvvatdaagnvnatqtemgnaavdktsvngqfkl
    iir