PDB entry 5iu9

View 5iu9 on RCSB PDB site
Description: crystal structure of zebrafish protocadherin-19 ec1-4
Deposited on 2016-03-17, released 2016-11-02
The last revision was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 3.59 Å
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protocadherin-19 isoform 1
    Species: Danio rerio [TaxId:7955]
    Gene: pcdh19
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Protocadherin-19 isoform 1
    Species: Danio rerio [TaxId:7955]
    Gene: pcdh19
    Database cross-references and differences (RAF-indexed):
    • Uniprot C4P340 (Start-422)
      • expression tag (423)
  • Heterogens: CA, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5iu9A (A:)
    mvfnlkytveeelragtkianvtadakvagfalgnrqpylrvisnseprwvnlspaglli
    tkqkidrdavcrqtpkcfislevmsnsmeicvikieiidvndnaprfptnhidieisena
    apgtrfplegasdpdsgsngiqtytitpndifgleiktrgdgskiaelvvektldretqs
    rytfeltaedggdppksgtvqlnikvidsndnnpvfdepvytvnvlenspintlvidlna
    tdpdegtngevvysfinfvsnltkqmfkidpktgvitvngvldheelhiheidvqakdlg
    pnsipahckvivnvidindnapeikllsensemvevsenaplgyvialvrvsdndsgang
    kvqcrlqgnvpfrlnefesfstllvdgrldreqrdmynltilaedsgypplrssksfavk
    vtdlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5iu9A (A:)
    vfnlkytveeelragtkianvtadakvagfapylrvisnseprwvnlspagllitkqkid
    rdavcrqtpkcfislevmsnsmeicvikieiidvndnaprfptnhidieisenaapgtrf
    plegasdpdsgsngiqtytitpndifgleiktrgdgskiaelvvektldretqsrytfel
    taedggdppksgtvqlnikvidsndnnpvfdepvytvnvlenspintlvidlnatdpdeg
    tngevvysfinfvsnltkqmfkidpktgvitvngvldheelhiheidvqakdlgpnsipa
    hckvivnvidindnapeikllsensemvevsenaplgyvialvrvsdndsgangkvqcrl
    qgnvpfrlnefesfstllvdgrldreqrdmynltilaedsgypplrssksfavkvtd
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5iu9B (B:)
    mvfnlkytveeelragtkianvtadakvagfalgnrqpylrvisnseprwvnlspaglli
    tkqkidrdavcrqtpkcfislevmsnsmeicvikieiidvndnaprfptnhidieisena
    apgtrfplegasdpdsgsngiqtytitpndifgleiktrgdgskiaelvvektldretqs
    rytfeltaedggdppksgtvqlnikvidsndnnpvfdepvytvnvlenspintlvidlna
    tdpdegtngevvysfinfvsnltkqmfkidpktgvitvngvldheelhiheidvqakdlg
    pnsipahckvivnvidindnapeikllsensemvevsenaplgyvialvrvsdndsgang
    kvqcrlqgnvpfrlnefesfstllvdgrldreqrdmynltilaedsgypplrssksfavk
    vtdlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5iu9B (B:)
    fnlkytveeelragtkianvtadakvagfalgnrqpylrvisnseprwvnlspagllitk
    qkidrdavcrqtpkcfislevmsnsmeicvikieiidvndnaprfptnhidieisenaap
    gtrfplegasdpdsgsngiqtytitpndifgleiktrgdgskiaelvvektldretqsry
    tfeltaedggdppksgtvqlnikvidsndnnpvfdepvytvnvlenspintlvidlnatd
    pdegtngevvysfinfvsnltkqmfkidpktgvitvngvldheelhiheidvqakdlgpn
    sipahckvivnvidindnapeikllsensemvevsenaplgyvialvrvsdndsgangkv
    qcrlqgnvpfrlnefesfstllvdgrldreqrdmynltilaedsgypplrssksfavkvt
    dl