PDB entry 5iu7

View 5iu7 on RCSB PDB site
Description: crystal structure of stabilized a2a adenosine receptor a2ar-star2-bril in complex with compound 12c at 1.9a resolution
Deposited on 2016-03-17, released 2016-06-29
The last revision was dated 2016-07-27, with a file datestamp of 2016-07-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenosine receptor A2a,Soluble cytochrome b562,Adenosine receptor A2a
    Species: Homo sapiens [TaxId:9606]
    Gene: ADORA2A, ADORA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29274 (10-216)
      • expression tag (5-9)
      • engineered mutation (62)
      • engineered mutation (96)
      • engineered mutation (115)
      • engineered mutation (130)
      • engineered mutation (162)
      • engineered mutation (210)
    • Uniprot P0ABE7 (217-322)
      • engineered mutation (223)
    • Uniprot P29274 (323-End)
      • engineered mutation (339)
      • engineered mutation (343)
      • engineered mutation (381)
  • Heterogens: NA, 6DY, CLR, OLA, OLB, OLC, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5iu7A (A:)
    dykddddgappimgssvyitvelaiavlailgnvlvcwavwlnsnlqnvtnyfvvslaaa
    dilvgvlaipfaitistgfcaachgclfiacfvlvlaqssifsllaiaidryiaiaiplr
    ynglvtgtraagiiaicwvlsfaigltpmlgwnncgqpkegkahsqgcgegqvaclfedv
    vpmnymvyfnffacvlvplllmlgvylrifaaarrqladlednwetlndnlkviekadna
    aqvkdaltkmraaaldaqkatppkledkspdspemkdfrhgfdilvgqiddalklanegk
    vkeaqaaaeqlkttrnayiqkylerarstlqkevhaaksaaiiaglfalcwlplhiincf
    tffcpdcshaplwlmylaivlahtnsvvnpfiyayrirefrqtfrkiirshvlrqqepfk
    aaahhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5iu7A (A:)
    ddgappimgssvyitvelaiavlailgnvlvcwavwlnsnlqnvtnyfvvslaaadilvg
    vlaipfaitistgfcaachgclfiacfvlvlaqssifsllaiaidryiaiaiplrynglv
    tgtraagiiaicwvlsfaigltpmlgwnncgqpkegkahsqgcgegqvaclfedvvpmny
    mvyfnffacvlvplllmlgvylrifaaarrqladlednwetlndnlkviekadnaaqvkd
    altkmraaaldaqkmkdfrhgfdilvgqiddalklanegkvkeaqaaaeqlkttrnayiq
    kylerarstlqkevhaaksaaiiaglfalcwlplhiincftffcpdcshaplwlmylaiv
    lahtnsvvnpfiyayrirefrqtfrkiirshv