PDB entry 5iu6

View 5iu6 on RCSB PDB site
Description: Crystal structure of E.coli purine nucleoside phosphorylase with 7-deazahypoxanthine
Class: transferase
Keywords: complex, transferase
Deposited on 2016-03-17, released 2017-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-05, with a file datestamp of 2017-03-31.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Purine nucleoside phosphorylase deoD-type
    Species: Escherichia coli [TaxId:562]
    Gene: deoD, pup, b4384, JW4347
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5iu6a_
  • Chain 'B':
    Compound: Purine nucleoside phosphorylase deoD-type
    Species: Escherichia coli [TaxId:562]
    Gene: deoD, pup, b4384, JW4347
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5iu6b_
  • Chain 'C':
    Compound: Purine nucleoside phosphorylase deoD-type
    Species: Escherichia coli [TaxId:562]
    Gene: deoD, pup, b4384, JW4347
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5iu6c_
  • Heterogens: 7HX, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5iu6A (A:)
    atphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisvm
    ghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrirf
    kdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgvem
    eaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5iu6B (B:)
    atphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisvm
    ghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrirf
    kdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgvem
    eaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5iu6C (C:)
    atphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisvm
    ghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrirf
    kdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgvem
    eaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdk