PDB entry 5iu2

View 5iu2 on RCSB PDB site
Description: discovery of imidazoquinolines as a novel class of potent, selective and in vivo efficacious cot kinase inhibitors
Deposited on 2016-03-17, released 2016-08-24
The last revision was dated 2016-09-07, with a file datestamp of 2016-09-02.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase kinase kinase 8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Mitogen-activated protein kinase kinase kinase 8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 6DA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5iu2A (A:)
    gpsgqevpwlssvrygtvedllafanhisntakhfygqrpqesgillnmvitpqngryqi
    dsdvllipwkltyrnigsdfiprgafgkvylaqdiktkkrmacklipvdqfkpsdveiqa
    cfrheniaelygavlwgetvhlfmeageggsvleklescgpmrefeiiwvtkhvlkgldf
    lhskkvihhdikpsnivfmstkavlvdfglsvqmtedvyfpkdlrgteiymspevilcrg
    hstkadiyslgatlihmqtgtppwvkryprsaypsylyiihkqapplediaddcspgmre
    lieaslernpnhrpraadllkhealnppredq
    

    Sequence, based on observed residues (ATOM records):
    >5iu2A (A:)
    lssvrygtvedllafanhisnfygqrpqesgillnmvitpqngryqidsdvllipwklty
    rngsdfiprgafgkvylaqdiktkkrmacklipvdqfkpsdveiqacfrheniaelygav
    lwgetvhlfmeageggsvleklescgpmrefeiiwvtkhvlkgldflhskkvihhdikps
    nivfmstkavlvdfglsvqmtedvyfpkdlrgteiymspevilcrghstkadiyslgatl
    ihmqtgtppwvkryprsaypsylyiihkqapplediaddcspgmrelieaslernpnhrp
    raadllkhealn
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5iu2B (B:)
    gpsgqevpwlssvrygtvedllafanhisntakhfygqrpqesgillnmvitpqngryqi
    dsdvllipwkltyrnigsdfiprgafgkvylaqdiktkkrmacklipvdqfkpsdveiqa
    cfrheniaelygavlwgetvhlfmeageggsvleklescgpmrefeiiwvtkhvlkgldf
    lhskkvihhdikpsnivfmstkavlvdfglsvqmtedvyfpkdlrgteiymspevilcrg
    hstkadiyslgatlihmqtgtppwvkryprsaypsylyiihkqapplediaddcspgmre
    lieaslernpnhrpraadllkhealnppredq
    

    Sequence, based on observed residues (ATOM records):
    >5iu2B (B:)
    lssvrygtvedllafanhisnhfygqrpqesgillnmvitpqngryqidsdvllipwklt
    yrngsdfiprgafgkvylaqdiktkkrmacklipvdqfkpsdveiqacfrheniaelyga
    vlwgetvhlfmeageggsvleklescgpmrefeiiwvtkhvlkgldflhskkvihhdikp
    snivfmstkavlvdfglsvqmtedvyfpkdlrgteiymspevilcrghstkadiyslgat
    lihmqtgtppwvkryprsaypsylyiihkqapplediaddcspgmrelieaslernpnhr
    praadllkhealn