PDB entry 5iu1

View 5iu1 on RCSB PDB site
Description: n-terminal pas domain homodimer of ppanr map3k from physcomitrella patens.
Deposited on 2016-03-17, released 2016-06-01
The last revision was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: XRAY
Resolution: 1.7000000000000002 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CTR1-like protein
    Species: Physcomitrella patens subsp. patens [TaxId:3218]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: CTR1-like protein
    Species: Physcomitrella patens subsp. patens [TaxId:3218]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, SO4, PEG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5iu1A (A:)
    sefesqpcvsidlrgnitswnraaeqlyqfkegevmgrnlvdlivppnaktaaldtimrv
    gqgevwigqfscvrrdnailntvvtqkpildddqkisgisvctepysmpelmarny
    

    Sequence, based on observed residues (ATOM records):
    >5iu1A (A:)
    fesqpcvsidlrgnitswnraaeqlyqfkegevmgrnlvdlivppnaktaaldtimrvgq
    gevwigqfscvrrdnailntvvtqkpildddqkisgisvctepysm
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5iu1B (B:)
    sefesqpcvsidlrgnitswnraaeqlyqfkegevmgrnlvdlivppnaktaaldtimrv
    gqgevwigqfscvrrdnailntvvtqkpildddqkisgisvctepysmpelmarny
    

    Sequence, based on observed residues (ATOM records):
    >5iu1B (B:)
    sqpcvsidlrgnitswnraaeqlyqfkegevmgrnlvdlivppnaktaaldtimrvgqge
    vwigqfscvrrdnailntvvtqkpildddqkisgisvctepysmpelmarny