PDB entry 5iu0

View 5iu0 on RCSB PDB site
Description: Rubisco from Arabidopsis thaliana
Class: lyase
Keywords: Ribulose-Bisphosphate-Carboxylase, Arabidopsis thaliana, lyase
Deposited on 2016-03-17, released 2017-07-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-07-12, with a file datestamp of 2017-07-07.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5iu0a1, d5iu0a2
  • Chain 'B':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5iu0b1, d5iu0b2
  • Chain 'I':
    Compound: Ribulose bisphosphate carboxylase small chain 1B, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5iu0i_
  • Chain 'J':
    Compound: Ribulose bisphosphate carboxylase small chain 1B, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5iu0j_
  • Heterogens: MG, CAP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5iu0A (A:)
    mspqtetkasvgfkagvkeykltyytpeyetkdtdilaafrvtpqpgvppeeagaavaae
    sstgtwttvwtdgltsldrykgrcyhiepvpgeetqfiayvaypldlfeegsvtnmftsi
    vgnvfgfkalaalrledlrippaytktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaeaiyksqaetgeikghyl
    natagtceemikravfarelgvpivmhdyltggftantslshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihagtvvgklegdrestlgfvdllrddyvekdrsr
    gifftqdwvslpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlavegneiireackwspelaaacevwkeitfnfptidkldgqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iu0A (A:)
    fkagvkeykltyytpeyetkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwtd
    gltsldrykgrcyhiepvpgeetqfiayvaypldlfeegsvtnmftsivgnvfgfkalaa
    lrledlrippaytktfqgpphgiqverdklnkygrpllgctikpklglsaknygravyec
    lrggldftkddenvnsqpfmrwrdrflfcaeaiyksqaetgeikghylnatagtceemik
    ravfarelgvpivmhdyltggftantslshycrdnglllhihramhavidrqknhgmhfr
    vlakalrlsggdhihagtvvgklegdrestlgfvdllrddyvekdrsrgifftqdwvslp
    gvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarn
    egrdlavegneiireackwspelaaacevwkeitfnfptidkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5iu0B (B:)
    mspqtetkasvgfkagvkeykltyytpeyetkdtdilaafrvtpqpgvppeeagaavaae
    sstgtwttvwtdgltsldrykgrcyhiepvpgeetqfiayvaypldlfeegsvtnmftsi
    vgnvfgfkalaalrledlrippaytktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaeaiyksqaetgeikghyl
    natagtceemikravfarelgvpivmhdyltggftantslshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihagtvvgklegdrestlgfvdllrddyvekdrsr
    gifftqdwvslpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlavegneiireackwspelaaacevwkeitfnfptidkldgqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iu0B (B:)
    fkagvkeykltyytpeyetkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwtd
    gltsldrykgrcyhiepvpgeetqfiayvaypldlfeegsvtnmftsivgnvfgfkalaa
    lrledlrippaytktfqgpphgiqverdklnkygrpllgctikpklglsaknygravyec
    lrggldftkddenvnsqpfmrwrdrflfcaeaiyksqaetgeikghylnatagtceemik
    ravfarelgvpivmhdyltggftantslshycrdnglllhihramhavidrqknhgmhfr
    vlakalrlsggdhihagtvvgklegdrestlgfvdllrddyvekdrsrgifftqdwvslp
    gvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarn
    egrdlavegneiireackwspelaaacevwkeitfnfptidkl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5iu0I (I:)
    massmlssaavvtspaqatmvapftglkssasfpvtrkannditsitsnggrvscmkvwp
    pigkkkfetlsylpdltdvelakevdyllrnkwipcvefelehgfvyrehgntpgyydgr
    ywtmwklplfgctdsaqvlkeveeckkeypgafiriigfdntrqvqcisfiaykppsftd
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iu0I (I:)
    mkvwppigkkkfetlsylpdltdvelakevdyllrnkwipcvefelehgfvyrehgntpg
    yydgrywtmwklplfgctdsaqvlkeveeckkeypgafiriigfdntrqvqcisfiaykp
    psf
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5iu0J (J:)
    massmlssaavvtspaqatmvapftglkssasfpvtrkannditsitsnggrvscmkvwp
    pigkkkfetlsylpdltdvelakevdyllrnkwipcvefelehgfvyrehgntpgyydgr
    ywtmwklplfgctdsaqvlkeveeckkeypgafiriigfdntrqvqcisfiaykppsftd
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iu0J (J:)
    mkvwppigkkkfetlsylpdltdvelakevdyllrnkwipcvefelehgfvyrehgntpg
    yydgrywtmwklplfgctdsaqvlkeveeckkeypgafiriigfdntrqvqcisfiaykp
    psf