PDB entry 5ity

View 5ity on RCSB PDB site
Description: crystal structure of human neil1(p2g) bound to duplex dna containing thymine glycol
Deposited on 2016-03-17, released 2016-07-06
The last revision was dated 2016-08-03, with a file datestamp of 2016-07-29.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endonuclease 8-like 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NEIL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96FI4
      • engineered mutation (1)
      • engineered mutation (241)
  • Chain 'B':
    Compound: Endonuclease 8-like 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NEIL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96FI4
      • engineered mutation (1)
      • engineered mutation (241)
  • Chain 'C':
    Compound: Endonuclease 8-like 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NEIL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96FI4
      • engineered mutation (1)
      • engineered mutation (241)
  • Chain 'D':
    Compound: DNA (26-mer)
    Species: UNIDENTIFIED, synthetic [TaxId:32644]
  • Chain 'E':
    Compound: DNA (26-mer)
    Species: UNIDENTIFIED, synthetic [TaxId:32644]
  • Chain 'F':
    Compound: DNA (26-mer)
    Species: UNIDENTIFIED, synthetic [TaxId:32644]
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ityA (A:)
    mgegpelhlasqfvneacralvfggcvekssvsrnpevpfessayrisasargkelrlil
    splpgaqpqqeplalvfrfgmsgsfqlvpreelprhahlrfytappgprlalcfvdirrf
    grwdlggkwqpgrgpcvlqeyqqfrenvlrnladkafdrpicealldqrffngignylra
    eilyrlkippfekarsvlealqqhrpspeltlsqkirtklqnpdllelchsvpkevvqlg
    grgygsesgeedfaafrawlrcygmpgmsslqdrhgrtiwfqgdpgplapkgrksrkkks
    katqlspedrvedalppskapsrtrrakrdlpkrtatqrpegtslqqdpeaptvpkkgrr
    kgrqaasghcrprkvkadipslepegtsasaalghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5ityA (A:)
    gegpelhlasqfvneacralvfggcvekssvsrnpevpfessayrisasargkelrlils
    plpgaqpqqeplalvfrfgmsgsfqlvpreelprhahlrfytappgprlalcfvdirrfg
    rwdlggkwqpgrgpcvlqeyqqfrenvlrnladkafdrpicealldqrffngignylrae
    ilyrlkippfekarsvlealqnpdllelchsvpkevvqlggrgyeedfaafrawlrcygm
    pgmsslqdrhgrtiwfqgdpgplap
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5ityB (B:)
    mgegpelhlasqfvneacralvfggcvekssvsrnpevpfessayrisasargkelrlil
    splpgaqpqqeplalvfrfgmsgsfqlvpreelprhahlrfytappgprlalcfvdirrf
    grwdlggkwqpgrgpcvlqeyqqfrenvlrnladkafdrpicealldqrffngignylra
    eilyrlkippfekarsvlealqqhrpspeltlsqkirtklqnpdllelchsvpkevvqlg
    grgygsesgeedfaafrawlrcygmpgmsslqdrhgrtiwfqgdpgplapkgrksrkkks
    katqlspedrvedalppskapsrtrrakrdlpkrtatqrpegtslqqdpeaptvpkkgrr
    kgrqaasghcrprkvkadipslepegtsasaalghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5ityB (B:)
    gegpelhlasqfvneacralvfggcvekssvsrnpevpfessayrisasargkelrlils
    plpgaqpqqeplalvfrfgmsgsfqlvpreelprhahlrfytappgprlalcfvdirrfg
    rwdlggkwqpgrgpcvlqeyqqfrenvlrnladkafdrpicealldqrffngignylrae
    ilyrlkippfekarsvlealnpdllelchsvpkevvqlggrgydfaafrawlrcygmpgm
    sslqdrhgrtiwfqgdpgplap
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5ityC (C:)
    mgegpelhlasqfvneacralvfggcvekssvsrnpevpfessayrisasargkelrlil
    splpgaqpqqeplalvfrfgmsgsfqlvpreelprhahlrfytappgprlalcfvdirrf
    grwdlggkwqpgrgpcvlqeyqqfrenvlrnladkafdrpicealldqrffngignylra
    eilyrlkippfekarsvlealqqhrpspeltlsqkirtklqnpdllelchsvpkevvqlg
    grgygsesgeedfaafrawlrcygmpgmsslqdrhgrtiwfqgdpgplapkgrksrkkks
    katqlspedrvedalppskapsrtrrakrdlpkrtatqrpegtslqqdpeaptvpkkgrr
    kgrqaasghcrprkvkadipslepegtsasaalghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5ityC (C:)
    gegpelhlasqfvneacralvfggcvekssvsrnpevpfessayrisasargkelrlils
    plpgaqpqqeplalvfrfgmsgsfqlvpreelprhahlrfytappgprlalcfvdirrfg
    rwdlggkwqpgrgpcvlqeyqqfrenvlrnladkafdrpicealldqrffngignylrae
    ilyrlkippfekarsvleanpdllelchsvpkevvqlggrgydfaafrawlrcygmpgms
    slqdrhgrtiwfqgdpgplap
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.