PDB entry 5itv

View 5itv on RCSB PDB site
Description: Crystal structure of Bacillus subtilis BacC Dihydroanticapsin 7-dehydrogenase in complex with NADH
Class: oxidoreductase
Keywords: oxidoreductase, short-chain dehydrogenases/reductases, Rossmann fold, NAD(P) binding domain
Deposited on 2016-03-17, released 2017-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydroanticapsin 7-dehydrogenase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: bacC, ywfD, BSU37720, ipa-82d
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39640 (2-254)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d5itva1, d5itva2
  • Chain 'B':
    Compound: Dihydroanticapsin 7-dehydrogenase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: bacC, ywfD, BSU37720, ipa-82d
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39640 (2-254)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d5itvb1, d5itvb2
  • Chain 'C':
    Compound: Dihydroanticapsin 7-dehydrogenase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: bacC, ywfD, BSU37720, ipa-82d
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39640 (2-254)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d5itvc1, d5itvc2
  • Chain 'D':
    Compound: Dihydroanticapsin 7-dehydrogenase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: bacC, ywfD, BSU37720, ipa-82d
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39640 (2-254)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d5itvd1, d5itvd2
  • Heterogens: NAI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5itvA (A:)
    mimnltdktvlitggasgigyaavqaflgqqanvvvadideaqgeamvrkenndrlhfvq
    tditdeaacqhavesavhtfggldvlinnagieivapihemelsdwnkvlqvnltgmflm
    skhalkhmlaagkgniintcsvgglvawpdipaynaskggvlqltksmavdyakhqirvn
    cvcpgiidtplneksflennegtleeikkekakvnpllrlgkpeeianvmlflasdlssy
    mtgsaitadggytaq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5itvB (B:)
    mimnltdktvlitggasgigyaavqaflgqqanvvvadideaqgeamvrkenndrlhfvq
    tditdeaacqhavesavhtfggldvlinnagieivapihemelsdwnkvlqvnltgmflm
    skhalkhmlaagkgniintcsvgglvawpdipaynaskggvlqltksmavdyakhqirvn
    cvcpgiidtplneksflennegtleeikkekakvnpllrlgkpeeianvmlflasdlssy
    mtgsaitadggytaq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5itvC (C:)
    mimnltdktvlitggasgigyaavqaflgqqanvvvadideaqgeamvrkenndrlhfvq
    tditdeaacqhavesavhtfggldvlinnagieivapihemelsdwnkvlqvnltgmflm
    skhalkhmlaagkgniintcsvgglvawpdipaynaskggvlqltksmavdyakhqirvn
    cvcpgiidtplneksflennegtleeikkekakvnpllrlgkpeeianvmlflasdlssy
    mtgsaitadggytaq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5itvD (D:)
    mimnltdktvlitggasgigyaavqaflgqqanvvvadideaqgeamvrkenndrlhfvq
    tditdeaacqhavesavhtfggldvlinnagieivapihemelsdwnkvlqvnltgmflm
    skhalkhmlaagkgniintcsvgglvawpdipaynaskggvlqltksmavdyakhqirvn
    cvcpgiidtplneksflennegtleeikkekakvnpllrlgkpeeianvmlflasdlssy
    mtgsaitadggytaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5itvD (D:)
    mimnltdktvlitggasgigyaavqaflgqqanvvvadideaqgeamvrkenndrlhfvq
    tditdeaacqhavesavhtfggldvlinnagieivapihemelsdwnkvlqvnltgmflm
    skhalkhmlaagkgniintcsvgglvawpdipaynaskggvlqltksmavdyakhqirvn
    cvcpgiidtlrlgkpeeianvmlflasdlssymtgsaitadggytaq