PDB entry 5itq

View 5itq on RCSB PDB site
Description: Crystal Structure of Human NEIL1, Free Protein
Class: DNA binding protein/DNA
Keywords: DNA glycosylase NEIL1 Fpg Nei base excision repair, DNA BINDING PROTEIN-DNA complex
Deposited on 2016-03-17, released 2016-07-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-07-06, with a file datestamp of 2016-07-01.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endonuclease 8-like 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NEIL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96FI4 (Start-289)
      • engineered mutation (146)
      • engineered mutation (241)
    Domains in SCOPe 2.06: d5itqa1, d5itqa2, d5itqa3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5itqA (A:)
    mpegpelhlasqfvneacralvfggcvekssvsrnpevpfessayrisasargkelrlil
    splpgaqpqqeplalvfrfgmsgsfqlvpreelprhahlrfytappgprlalcfvdirrf
    grwdlggkwqpgrgpcvlqeyqqfresvlrnladkafdrpicealldqrffngignylra
    eilyrlkippfekarsvlealqqhrpspeltlsqkirtklqnpdllelchsvpkevvqlg
    grgygsesgeedfaafrawlrcygmpgmsslqdrhgrtiwfqgdpgplap
    

    Sequence, based on observed residues (ATOM records): (download)
    >5itqA (A:)
    pegpelhlasqfvneacralvfggcvekssvsrnpevpfessayrisasargkelrlils
    plpgaqpqqeplalvfrfgmsgsfqlvpreelprhahlrfytappgprlalcfvdirrfg
    rwdlggkwqpgrgpcvlqeyqqfresvlrnladkafdrpicealldqrffngignylrae
    ilyrlkippfekarsvlealqqspeltlsqkirtklqnpdllelchsvpkevvqlggrgy
    gsesgeedfaafrawlrcygmpgmsslqdrhgrtiwfqgdpgplap