PDB entry 5itb

View 5itb on RCSB PDB site
Description: Crystal structure of the anti-RSV F Fab 14N4
Class: immune system
Keywords: antibody, IMMUNE SYSTEM
Deposited on 2016-03-16, released 2016-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: anti-RSV F Fab 14N4 Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5ITB (2-214)
  • Chain 'L':
    Compound: anti-RSV F Fab 14N4 Light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5ITB (7-203)
    Domains in SCOPe 2.07: d5itbl1, d5itbl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5itbL (L:)
    sdiqmtqspstlsasvgdrvtitcrasqsisswlawyqqkpgkapklliydasslesgvp
    srfsgsgsgteftltisslqpddfatyycqqyntyswwtfgqgtkvdikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5itbL (L:)
    diqmtqspstlsasvgdrvtitcrasqsisswlawyqqkpgkapklliydasslesgvps
    rfsgsgsgteftltisslqpddfatyycqqyntyswwtfgqgtkvdikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec