PDB entry 5it6

View 5it6 on RCSB PDB site
Description: Galectin-related protein: an integral member of the network of chicken galectins
Class: cell adhesion
Keywords: adhesion, lectin, phylogenesis, proliferation, cell adhesion
Deposited on 2016-03-16, released 2016-07-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-07-13, with a file datestamp of 2016-07-08.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin-related protein
    Species: Gallus gallus [TaxId:9031]
    Gene: LGALSL, GRP, RCJMB04_34j3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5it6a_
  • Heterogens: SO4, PEG, PGE, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5it6A (A:)
pfcghikggmrpgkkilvmgivdlnpesfgisltcgesedppadvaielkavftdrqfir
nscvagewgeeqssipyfpfipdqpfrveilcehprfrifvdghqlfdfyhrietlsaid
tikingdlqltklg