PDB entry 5it2

View 5it2 on RCSB PDB site
Description: Structure of a transglutaminase 2-specific autoantibody 693-10-B06 Fab fragment
Class: immune system
Keywords: Transglutaminase 2, autoantibody, Fab fragment, IMMUNE SYSTEM
Deposited on 2016-03-16, released 2017-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-22, with a file datestamp of 2017-03-17.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IT2 (0-End)
  • Chain 'L':
    Compound: light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IT2 (0-214)
    Domains in SCOPe 2.07: d5it2l1, d5it2l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5it2L (L:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgktpklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsysnlmysfgqgtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec