PDB entry 5it1

View 5it1 on RCSB PDB site
Description: Streptomyces peucetius CYP105P2 complex with biphenyl compound
Class: oxidoreductase
Keywords: CYP105P2-biphenyl compound complex, OXIDOREDUCTASE
Deposited on 2016-03-16, released 2016-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-06-15, with a file datestamp of 2016-06-10.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative cytochrome P450
    Species: Streptomyces peucetius [TaxId:1950]
    Gene: cyp7863
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5it1a_
  • Chain 'B':
    Compound: putative cytochrome P450
    Species: Streptomyces peucetius [TaxId:1950]
    Gene: cyp7863
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5it1b_
  • Chain 'C':
    Compound: putative cytochrome P450
    Species: Streptomyces peucetius [TaxId:1950]
    Gene: cyp7863
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5it1c_
  • Chain 'D':
    Compound: putative cytochrome P450
    Species: Streptomyces peucetius [TaxId:1950]
    Gene: cyp7863
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5it1d_
  • Heterogens: HEM, 2OH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5it1A (A:)
    msqptagapaapkarscpflppdgiadiraaapvtratftsgheawlvtgyeqvravlrd
    psfsvgvphalhtqdgvvtqkpgrgsllwqdapehtddrkllakeftvrrmqalrpniqr
    ivdehldaiearggpvdlvktfanpvpsmvisdlfgvpaerraefqeiaeammrvdqdaa
    ateaagmrlggllyqlvqerranpgddlisalittedpdgviddmflmnaagtlliaahd
    ttacmiglgtallldrpdqlallqkdpslignaveellryltigqfgaervatqdgeigg
    vriakgeqvvthllsadfdpafvedperfditrrpaphlafgfgahqcigqqlarielqi
    vfgtlfrrfptlrlakpveelrfrndmvfygvhelpvtw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5it1A (A:)
    tagapaapkarscpflppdgiadiraaapvtratftsgheawlvtgyeqvravlrdpsfs
    vgvphalhtqdgvvtqkpgrgsllwqdapehtddrkllakeftvrrmqalrpniqrivde
    hldaiearggpvdlvktfanpvpsmvisdlfgvpaerraefqeiaeammrvdqdaaatea
    agmrlggllyqlvqerranpgddlisalittedpdgviddmflmnaagtlliaahdttac
    miglgtallldrpdqlallqkdpslignaveellryltigqfgaervatqdgeiggvria
    kgeqvvthllsadfdpafvedperfditrrpaphlafgfgahqcigqqlarielqivfgt
    lfrrfptlrlakpveelrfrndmvfygvhelpvtw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5it1B (B:)
    msqptagapaapkarscpflppdgiadiraaapvtratftsgheawlvtgyeqvravlrd
    psfsvgvphalhtqdgvvtqkpgrgsllwqdapehtddrkllakeftvrrmqalrpniqr
    ivdehldaiearggpvdlvktfanpvpsmvisdlfgvpaerraefqeiaeammrvdqdaa
    ateaagmrlggllyqlvqerranpgddlisalittedpdgviddmflmnaagtlliaahd
    ttacmiglgtallldrpdqlallqkdpslignaveellryltigqfgaervatqdgeigg
    vriakgeqvvthllsadfdpafvedperfditrrpaphlafgfgahqcigqqlarielqi
    vfgtlfrrfptlrlakpveelrfrndmvfygvhelpvtw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5it1B (B:)
    tagapaapkarscpflppdgiadiraaapvtratftsgheawlvtgyeqvravlrdpsfs
    vgvphalhtqdgvvtqkpgrgsllwqdapehtddrkllakeftvrrmqalrpniqrivde
    hldaiearggpvdlvktfanpvpsmvisdlfgvpaerraefqeiaeammrvdqdaaatea
    agmrlggllyqlvqerranpgddlisalittedpdgviddmflmnaagtlliaahdttac
    miglgtallldrpdqlallqkdpslignaveellryltigqfgaervatqdgeiggvria
    kgeqvvthllsadfdpafvedperfditrrpaphlafgfgahqcigqqlarielqivfgt
    lfrrfptlrlakpveelrfrndmvfygvhelpvtw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5it1C (C:)
    msqptagapaapkarscpflppdgiadiraaapvtratftsgheawlvtgyeqvravlrd
    psfsvgvphalhtqdgvvtqkpgrgsllwqdapehtddrkllakeftvrrmqalrpniqr
    ivdehldaiearggpvdlvktfanpvpsmvisdlfgvpaerraefqeiaeammrvdqdaa
    ateaagmrlggllyqlvqerranpgddlisalittedpdgviddmflmnaagtlliaahd
    ttacmiglgtallldrpdqlallqkdpslignaveellryltigqfgaervatqdgeigg
    vriakgeqvvthllsadfdpafvedperfditrrpaphlafgfgahqcigqqlarielqi
    vfgtlfrrfptlrlakpveelrfrndmvfygvhelpvtw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5it1C (C:)
    tagapaapkarscpflppdgiadiraaapvtratftsgheawlvtgyeqvravlrdpsfs
    vgvphalhtqdgvvtqkpgrgsllwqdapehtddrkllakeftvrrmqalrpniqrivde
    hldaiearggpvdlvktfanpvpsmvisdlfgvpaerraefqeiaeammrvdqdaaatea
    agmrlggllyqlvqerranpgddlisalittedpdgviddmflmnaagtlliaahdttac
    miglgtallldrpdqlallqkdpslignaveellryltigqfgaervatqdgeiggvria
    kgeqvvthllsadfdpafvedperfditrrpaphlafgfgahqcigqqlarielqivfgt
    lfrrfptlrlakpveelrfrndmvfygvhelpvtw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5it1D (D:)
    msqptagapaapkarscpflppdgiadiraaapvtratftsgheawlvtgyeqvravlrd
    psfsvgvphalhtqdgvvtqkpgrgsllwqdapehtddrkllakeftvrrmqalrpniqr
    ivdehldaiearggpvdlvktfanpvpsmvisdlfgvpaerraefqeiaeammrvdqdaa
    ateaagmrlggllyqlvqerranpgddlisalittedpdgviddmflmnaagtlliaahd
    ttacmiglgtallldrpdqlallqkdpslignaveellryltigqfgaervatqdgeigg
    vriakgeqvvthllsadfdpafvedperfditrrpaphlafgfgahqcigqqlarielqi
    vfgtlfrrfptlrlakpveelrfrndmvfygvhelpvtw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5it1D (D:)
    tagapaapkarscpflppdgiadiraaapvtratftsgheawlvtgyeqvravlrdpsfs
    vgvphalhtqdgvvtqkpgrgsllwqdapehtddrkllakeftvrrmqalrpniqrivde
    hldaiearggpvdlvktfanpvpsmvisdlfgvpaerraefqeiaeammrvdqdaaatea
    agmrlggllyqlvqerranpgddlisalittedpdgviddmflmnaagtlliaahdttac
    miglgtallldrpdqlallqkdpslignaveellryltigqfgaervatqdgeiggvria
    kgeqvvthllsadfdpafvedperfditrrpaphlafgfgahqcigqqlarielqivfgt
    lfrrfptlrlakpveelrfrndmvfygvhelpvtw